Details of PSQ01029
| ProSeqID |
PSQ01029 |
| Family |
FD00075 |
| Protein Name |
Zona pellucida sperm-binding protein 3 |
| UniProt ID |
P10761
|
| Taxonomy |
Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Mammalia-Eutheria-Euarchontoglires-Glires-Rodentia-Myomorpha-Muroidea-Muridae-Murinae-Mus-Mus |
| Organisms |
Mus musculus (Mouse) |
| Prosequence Length (aa) |
73 |
| Functions |
acrosin binding, carbohydrate binding, identical protein binding, receptor ligand activity, structural constituent of egg coat |
| Preproprotein Length (aa) |
424 |
| Alt Name |
Sperm receptor, Zona pellucida glycoprotein 3, Zona pellucida protein C |
| Gene Name |
Zp3 |
| NCBI ID |
10090 |
| Cellular Localization |
collagen-containing extracellular matrix, egg coat, extracellular matrix, extracellular space, integral component of membrane, plasma membrane |
| Processes |
binding of sperm to zona pellucida, blastocyst formation, egg coat formation, humoral immune response mediated by circulating immunoglobulin, negative regulation of binding of sperm to zona pellucida, negative regulation of transcription, DNA-templated, oocyte development, phosphatidylinositol-mediated signaling, positive regulation of acrosomal vesicle exocytosis, positive regulation of acrosome reaction, positive regulation of antral ovarian follicle growth, positive regulation of humoral immune response, positive regulation of inflammatory response, positive regulation of interferon-gamma production, positive regulation of interleukin-4 production, positive regulation of leukocyte migration, positive regulation of ovarian follicle development, positive regulation of T cell proliferation, positive regulation of transcription, DNA-templated, positive regulation of type IV hypersensitivity, regulation of signaling receptor activity |
| PubMed |
12799386
|
| Total Prosequence Length (aa) |
73 |
| Prosequence Location |
352:424 |
| Prosequence Sequence |
RRHVTDEADVTVGPLIFLGKANDQTVEGWTASAQTSVALGLGLATVAFLTLAAIVLAVTRKCHSSSYLVSLPQ |
| Preproprotein Sequence |
MASSYFLFLCLLLCGGPELCNSQTLWLLPGGTPTPVGSSSPVKVECLEAELVVTVSRDLFGTGKLVQPGDLTLGSEGCQPRVSVDTDVVRFNAQLHECSSRVQMTKDALVYSTFLLHDPRPVSGLSILRTNRVEVPIECRYPRQGNVSSHPIQPTWVPFRATVSSEEKLAFSLRLMEENWNTEKSAPTFHLGEVAHLQAEVQTGSHLPLQLFVDHCVATPSPLPDPNSSPYHFIVDFHGCLVDGLSESFSAFQVPRPRPETLQFTVDVFHFANSSRNTLYITCHLKVAPANQIPDKLNKACSFNKTSQSWLPVEGDADICDCCSHGNCSNSSSSQFQIHGPRQWSKLVSRNRRHVTDEADVTVGPLIFLGKANDQTVEGWTASAQTSVALGLGLATVAFLTLAAIVLAVTRKCHSSSYLVSLPQ |
