Details of PSQ01033
| ProSeqID |
PSQ01033 |
| Family |
FD00135 |
| Protein Name |
Secretin |
| UniProt ID |
P11384
|
| Taxonomy |
Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Mammalia-Eutheria-Euarchontoglires-Glires-Rodentia-Myomorpha-Muroidea-Muridae-Murinae-Rattus |
| Organisms |
Rattus norvegicus (Rat) |
| Prosequence Length (aa) |
10, 72 |
| Functions |
digestive hormone activity, G protein-coupled receptor binding, hormone activity, protein N-terminus binding, signaling receptor binding |
| Preproprotein Length (aa) |
134 |
| Alt Name |
None |
| Gene Name |
Sct |
| NCBI ID |
10116 |
| Cellular Localization |
extracellular space |
| Processes |
brain development, cellular water homeostasis, dentate gyrus development, diet induced thermogenesis, embryonic digestive tract development, hippocampus development, negative regulation of gastrin-induced gastric acid secretion, negative regulation of neuron apoptotic process, neuronal stem cell population maintenance, positive regulation of cAMP-mediated signaling, positive regulation of lipid catabolic process, positive regulation of pancreatic juice secretion, positive regulation of somatostatin secretion, regulation of appetite, regulation of synaptic plasticity, response to nutrient levels, visual learning |
| PubMed |
27197042719704
|
| Total Prosequence Length (aa) |
82 |
| Prosequence Location |
22:31, 63:134 |
| Prosequence Sequence |
FVLPAPPRTP, SEEDTENIPENSVARPKPLEDQLCLLWSNTQALQDWLLPRLSLDGSLSLWLPPGPRPAVDHSEWTETTRQPR |
| Preproprotein Sequence |
MEPLLPTPPLLLLLLLLLSSSFVLPAPPRTPRHSDGTFTSELSRLQDSARLQRLLQGLVGKRSEEDTENIPENSVARPKPLEDQLCLLWSNTQALQDWLLPRLSLDGSLSLWLPPGPRPAVDHSEWTETTRQPR |
