Home Advance Search BLAST Contact Documentation/Help Feedback

Details of PSQ01045

ProSeqID PSQ01045
Family FND00348
Protein Name Neuromedin-U
UniProt ID P12760
Taxonomy Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Mammalia-Eutheria-Euarchontoglires-Glires-Rodentia-Myomorpha-Muroidea-Muridae-Murinae-Rattus
Organisms Rattus norvegicus (Rat)
Prosequence Length (aa) 68
Functions neuromedin U receptor binding, type 1 neuromedin U receptor binding, type 2 neuromedin U receptor binding
Preproprotein Length (aa) 180
Alt Name None
Gene Name Nmu
NCBI ID 10116
Cellular Localization extracellular region, terminal bouton
Processes eating behavior, energy homeostasis, gastric acid secretion, negative regulation of eating behavior, negative regulation of feeding behavior, negative regulation of gastric acid secretion, negative regulation of gastric emptying, neuropeptide signaling pathway, photoperiodism, positive regulation of cytosolic calcium ion concentration, positive regulation of heart rate, positive regulation of heat generation, positive regulation of hormone secretion, positive regulation of prolactin secretion, positive regulation of sensory perception of pain, positive regulation of smooth muscle contraction, positive regulation of stomach fundus smooth muscle contraction, positive regulation of synaptic transmission, positive regulation of systemic arterial blood pressure, regulation of circadian sleep/wake cycle, sleep, regulation of feeding behavior, regulation of grooming behavior, sensory perception of pain, temperature homeostasis
PubMed 28874765
Total Prosequence Length (aa) 68
Prosequence Location 38:105
Prosequence Sequence CRGTPISPQRLPPEQELQLWNEIPEACASFLSVDSQPQASVALRKLCRVLMEIFQKPQEQTEKDNAKR
Preproprotein Sequence MSRAANRRPGLSAGQLAAATASPLLSLLLLLACCADACRGTPISPQRLPPEQELQLWNEIPEACASFLSVDSQPQASVALRKLCRVLMEIFQKPQEQTEKDNAKRFLFHYSKTQKLGNSNVVSSVVHPLLQLVPQLHERRMKRYKVNEYQGPVAPSGGFFLFRPRNGKRSTSFIn