ProSeqID | PSQ01045 |
Family | FND00348 |
Protein Name | Neuromedin-U |
UniProt ID | P12760 |
Taxonomy | Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Mammalia-Eutheria-Euarchontoglires-Glires-Rodentia-Myomorpha-Muroidea-Muridae-Murinae-Rattus |
Organisms | Rattus norvegicus (Rat) |
Prosequence Length (aa) | 68 |
Functions | neuromedin U receptor binding, type 1 neuromedin U receptor binding, type 2 neuromedin U receptor binding |
Preproprotein Length (aa) | 180 |
Alt Name | None |
Gene Name | Nmu |
NCBI ID | 10116 |
Cellular Localization | extracellular region, terminal bouton |
Processes | eating behavior, energy homeostasis, gastric acid secretion, negative regulation of eating behavior, negative regulation of feeding behavior, negative regulation of gastric acid secretion, negative regulation of gastric emptying, neuropeptide signaling pathway, photoperiodism, positive regulation of cytosolic calcium ion concentration, positive regulation of heart rate, positive regulation of heat generation, positive regulation of hormone secretion, positive regulation of prolactin secretion, positive regulation of sensory perception of pain, positive regulation of smooth muscle contraction, positive regulation of stomach fundus smooth muscle contraction, positive regulation of synaptic transmission, positive regulation of systemic arterial blood pressure, regulation of circadian sleep/wake cycle, sleep, regulation of feeding behavior, regulation of grooming behavior, sensory perception of pain, temperature homeostasis |
PubMed | 28874765 |
Total Prosequence Length (aa) | 68 |
Prosequence Location | 38:105 |
Prosequence Sequence | CRGTPISPQRLPPEQELQLWNEIPEACASFLSVDSQPQASVALRKLCRVLMEIFQKPQEQTEKDNAKR |
Preproprotein Sequence | MSRAANRRPGLSAGQLAAATASPLLSLLLLLACCADACRGTPISPQRLPPEQELQLWNEIPEACASFLSVDSQPQASVALRKLCRVLMEIFQKPQEQTEKDNAKRFLFHYSKTQKLGNSNVVSSVVHPLLQLVPQLHERRMKRYKVNEYQGPVAPSGGFFLFRPRNGKRSTSFIn |