Details of PSQ01031
| ProSeqID |
PSQ01031 |
| Family |
FD00031 |
| Protein Name |
Phormicin |
| UniProt ID |
P10891
|
| Taxonomy |
Eukaryota-Metazoa-Ecdysozoa-Arthropoda-Hexapoda-Insecta-Pterygota-Neoptera-Holometabola-Diptera-Brachycera-Muscomorpha-Oestroidea-Calliphoridae-Chrysomyinae-Protophormia |
| Organisms |
Protophormia terraenovae (Northern blowfly) (Lucilia terraenovae) |
| Prosequence Length (aa) |
31 |
| Functions |
None |
| Preproprotein Length (aa) |
94 |
| Alt Name |
Insect defensin A |
| Gene Name |
None |
| NCBI ID |
34676 |
| Cellular Localization |
extracellular region |
| Processes |
defense response to bacterium, innate immune response |
| PubMed |
2911573
|
| Total Prosequence Length (aa) |
31 |
| Prosequence Location |
24:54 |
| Prosequence Sequence |
IPADAANDAHFVDGVQALKEIEPELHGRYKR |
| Preproprotein Sequence |
MKFFMVFVVTFCLAVCFVSQSLAIPADAANDAHFVDGVQALKEIEPELHGRYKRATCDLLSGTGINHSACAAHCLLRGNRGGYCNGKGVCVCRN |