Home Advance Search BLAST Contact Documentation/Help Feedback

Details of PSQ01848

ProSeqID PSQ01848
Family FD00037
Protein Name Bradykinin-potentiating and C-type natriuretic peptides
UniProt ID Q6LEM5
Taxonomy Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Lepidosauria-Squamata-Bifurcata-Unidentata-Episquamata-Toxicofera-Serpentes-Colubroidea-Viperidae-Crotalinae-Bothrops
Organisms Bothrops jararaca (Jararaca) (Bothrops jajaraca)
Prosequence Length (aa) 7
Functions hormone activity, metalloendopeptidase inhibitor activity, peptidyl-dipeptidase inhibitor activity, toxin activity
Preproprotein Length (aa) 256
Alt Name BPP-CNP
Gene Name None
NCBI ID 8724
Cellular Localization cytosol, extracellular region
Processes blood vessel diameter maintenance, negative regulation of protein kinase activity, regulation of blood pressure, vasodilation
PubMed 15245866
Total Prosequence Length (aa) 7
Prosequence Location 78:84
Prosequence Sequence LTVQQWA
Preproprotein Sequence MVLSRLAASGLLLLALLALSVDGKPVQQWAQSWPGPNIPPLKVQQWAQGGWPRPGPEIPPLTVQQWAQNWPHPQIPPLTVQQWAQGRAPGPPIPPLTVQQWAQGRAPHPPIPPAPLQKWAPLQKWAPLLQPHESPASGTTALREELSLGPEAASGVPSAGAEVGRSGSKAPAAPHRLSKSKGAAATRPMRDLRPDGKQARQNWGRMAHHDHHAAAGGGGGGGGGARRLKGLAKKGAAKGCFGLKLDRIGTMSGLGC