Proseq ID | Family | Protein Name ![]() |
Uniprot ID | Taxonomy | Organism | Prosequence length![]() |
Functions | Preproprotein length | Alter Name | Gene Name | NCBI ID | Cell Org | Process | PubMed | Total Proseq length | Proseq Loc | Prosequence Sequence | |
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
PSQ00201 | FND00321 | U18-theraphotoxin-Cg1a | B1P1F5 | Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Theraphosidae Chilobrachys | Chilobrachys guangxiensis (Chinese earth tiger tarantula) (Chilobrachys, jingzhao) | 29 | ion channel inhibitor activity, toxin activity | 86 | Jingzhaotoxin-32 , Jingzhaotoxin-9 , Jingzhaotoxin-IX , Peptide F6-16 | None | 278060 | extracellular region | pathogenesis | 17476710, 19409400 | 29 | 21:49 | AELEERGSDQRDSPALIKSMAKVFQSEER | |
PSQ00202 | FD00001 | Mu-theraphotoxin-Cg1a | B1P1F7 | Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Theraphosidae Chilobrachys | Chilobrachys guangxiensis (Chinese earth tiger tarantula) (Chilobrachys, jingzhao) | 29 | ion channel inhibitor activity, toxin activity | 87 | Jingzhaotoxin-34 , Peptide F6-25 | None | 278060 | extracellular region | pathogenesis | 17476710 | 29 | 22:50 | AELEERGSDQRDSPAWVKSMERIFQSEER | |
PSQ00203 | FD00001 | U20-theraphotoxin-Cg1a 2 | B1P1F8 | Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Theraphosidae Chilobrachys | Chilobrachys guangxiensis (Chinese earth tiger tarantula) (Chilobrachys, jingzhao) | 26 | ion channel inhibitor activity, toxin activity | 83 | Jingzhaotoxin-35, Peptide F3-18 | None | 278060 | extracellular region | pathogenesis | 17476710 | 26 | 22:47 | AELEERGSDQPAWLKSLERIFQSEER | |
PSQ00204 | FD00001 | U20-theraphotoxin-Cg1a 1 | B1P1F9 | Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Theraphosidae Chilobrachys | Chilobrachys guangxiensis (Chinese earth tiger tarantula) (Chilobrachys, jingzhao) | 26 | ion channel inhibitor activity, toxin activity | 83 | Jingzhaotoxin-35, Peptide F3-18 | None | 278060 | extracellular region | pathogenesis | 17476710 | 26 | 22:47 | AELEERGSDQPAWLKSLERIFQSEER | |
PSQ00205 | FD00001 | U21-theraphotoxin-Cg1a 2 | B1P1G0 | Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Theraphosidae Chilobrachys | Chilobrachys guangxiensis (Chinese earth tiger tarantula) (Chilobrachys, jingzhao) | 26 | ion channel inhibitor activity, toxin activity | 84 | Jingzhaotoxin-38, Peptide F4-25 | None | 278060 | extracellular region | pathogenesis | 17476710 | 26 | 22:47 | EERGSDQMDSPAWLKSMEIIFQSEER | |
PSQ00206 | FD00001 | U21-theraphotoxin-Cg1a 1 | B1P1G2 | Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Theraphosidae Chilobrachys | Chilobrachys guangxiensis (Chinese earth tiger tarantula) (Chilobrachys, jingzhao) | 26 | ion channel inhibitor activity, toxin activity | 84 | Jingzhaotoxin-38, Peptide F4-25 | None | 278060 | extracellular region | pathogenesis | 17476710 | 26 | 22:47 | EERGSDQMDSPAWLKSMEIIFQSEER | |
PSQ00207 | FD00001 | U21-theraphotoxin-Cg1a 3 | B1P1G3 | Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Theraphosidae Chilobrachys | Chilobrachys guangxiensis (Chinese earth tiger tarantula) (Chilobrachys, jingzhao) | 26 | ion channel inhibitor activity, toxin activity | 84 | Jingzhaotoxin-38, Peptide F4-25 | None | 278060 | extracellular region | pathogenesis | 17476710 | 26 | 22:47 | EERGSDQMDSPAWLKSMERIFQSEER | |
PSQ00208 | FD00001 | U21-theraphotoxin-Cg1b | B1P1G4 | Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Theraphosidae Chilobrachys | Chilobrachys guangxiensis (Chinese earth tiger tarantula) (Chilobrachys, jingzhao) | 26 | ion channel inhibitor activity, toxin activity | 84 | Jingzhaotoxin-39, Peptide F4-28 | None | 278060 | extracellular region | pathogenesis | 17476710 | 26 | 22:47 | EERGSDQMDSPAWLKSMERIFQSEER | |
PSQ00209 | FD00001 | U22-theraphotoxin-Cg1a | B1P1G8 | Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Theraphosidae Chilobrachys | Chilobrachys guangxiensis (Chinese earth tiger tarantula) (Chilobrachys, jingzhao) | 31 | ion channel inhibitor activity, toxin activity | 86 | Jingzhaotoxin-44, Peptide F6-26 | None | 278060 | extracellular region | pathogenesis | 17476710 | 31 | 21:51 | SEFEEKELVKEVVRTIFLGKEDAALREETDR | |
PSQ00210 | FND00260 | U24-theraphotoxin-Cg1a | B1P1H2 | Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Theraphosidae Chilobrachys | Chilobrachys guangxiensis (Chinese earth tiger tarantula) (Chilobrachys, jingzhao) | 25 | ion channel inhibitor activity, toxin activity | 79 | Jingzhaotoxin-27, Peptide F2-36 | None | 278060 | extracellular region | pathogenesis | 17476710 | 25 | 20:44 | SEMKDRSSRNEVLSAIFAIEEPQER | |
PSQ00211 | FND00055 | U25-theraphotoxin-Cg1a | B1P1H3 | Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Theraphosidae Chilobrachys | Chilobrachys guangxiensis (Chinese earth tiger tarantula) (Chilobrachys, jingzhao) | 25 | toxin activity | 83 | Jingzhaotoxin-54, Peptide F1-20 | None | 278060 | extracellular region | None | 17476710 | 25 | 24:48 | QHPGLEKSGMFHENVGKGQHIEEKR | |
PSQ00212 | FND00055 | U25-theraphotoxin-Cg1a | B1P1H4 | Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Theraphosidae Chilobrachys | Chilobrachys guangxiensis (Chinese earth tiger tarantula) (Chilobrachys, jingzhao) | 25 | toxin activity | 83 | Jingzhaotoxin-54, Peptide F1-20 | None | 278060 | extracellular region | None | 17476710 | 25 | 24:48 | QHPGLKKSGMFHENVGKGQHIEKKR | |
PSQ00213 | FND00320 | U30-theraphotoxin-Cg1b | B1P1I2 | Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Theraphosidae Chilobrachys | Chilobrachys guangxiensis (Chinese earth tiger tarantula) (Chilobrachys, jingzhao) | 36 | ion channel inhibitor activity, toxin activity | 120 | Jingzhaotoxin-63, Peptide F5-9 | None | 278060 | extracellular region | pathogenesis | 17476710 | 36 | 18:53 | LETQKEIAEGNELTREETPSLVEHKEDEAAAASEKR | |
PSQ00214 | FND00051 | U32-theraphotoxin-Cg1a | B1P1I5 | Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Theraphosidae Chilobrachys | Chilobrachys guangxiensis (Chinese earth tiger tarantula) (Chilobrachys, jingzhao) | 24 | toxin activity | 110 | Jingzhaotoxin-66, Peptide F8-12 | None | 278060 | extracellular region | None | 17476710 | 24 | 20:43 | LEENEEYPDEDEMIESFMDGYSYR | |
PSQ00215 | FND00051 | U32-theraphotoxin-Cg1a | B1P1I6 | Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Theraphosidae Chilobrachys | Chilobrachys guangxiensis (Chinese earth tiger tarantula) (Chilobrachys, jingzhao) | 24 | toxin activity | 110 | Jingzhaotoxin-66, Peptide F8-12 | None | 278060 | extracellular region | None | 17476710 | 24 | 20:43 | LEENEEYPDEDEMIESFMDGYSYR | |
PSQ00216 | FD00430 | SE-cephalotoxin | B2DCR8 | Eukaryota Metazoa Spiralia Lophotrochozoa Mollusca Cephalopoda Coleoidea Decapodiformes Sepiida Sepiina Sepiidae Sepia | Sepia esculenta (Golden cuttlefish) (Diphtherosepion dabryi) | 8 | toxin activity | 1052 | None | None | 31210 | extracellular region | None | 18694775 | 8 | 22:29 | APPEIHTT | |
PSQ00217 | FND00364 | Conomarphin | B2KPN7 | Eukaryota Metazoa Spiralia Lophotrochozoa Mollusca Gastropoda Caenogastropoda Neogastropoda Conoidea Conidae Conus Conus | Conus marmoreus (Marble cone) | 33 | ion channel inhibitor activity, toxin activity | 71 | Marmophine | None | 42752 | extracellular region | pathogenesis | 18355315 | 33 | 22:54 | QLDGDQTADRHADQRGQDLTEQQRNSKRVLKKR | |
PSQ00218 | FND00325 | Longicornsin | B2MW54 | Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Acari Parasitiformes Ixodida Ixodoidea Ixodidae Haemaphysalinae Haemaphysalis | Haemaphysalis longicornis (Bush tick) | 7 | None | 78 | None | sGDLP | 44386 | extracellular region | defense response to bacterium, defense response to fungus, hemolysis in other organism, innate immune response | 20027626 | 7 | 23:29 | EEAHLRS | |
PSQ00219 | FD00063 | Major fimbrium subunit FimA type-1 | B2RH54 | Bacteria Bacteroidetes Bacteroidia Bacteroidales Porphyromonadaceae Porphyromonas | Porphyromonas gingivalis (strain ATCC 33277 , 12257 | 28 | structural molecule activity | 383 | Fimbrillin, Major fimbrial subunit protein type I | fimA | 431947 | cell outer membrane, pilus | cell adhesion, pathogenesis | 8778568, 9786913 | 28 | 19:46 | CNKDNEAEPVTEGNATISVVLKTSNSNR | |
PSQ00220 | FD00157 | Minor fimbrium subunit Mfa1 | B2RHG1 | Bacteria Bacteroidetes Bacteroidia Bacteroidales Porphyromonadaceae Porphyromonas | Porphyromonas gingivalis (strain ATCC 33277 , 12257 | 30 | None | 563 | Pg-II fim a | mfa1 | 431947 | cell outer membrane, outer membrane, pilus shaft | cell-cell adhesion, pathogenesis | 9786913 | 30 | 20:49 | CSKEGNGPDPDNAAKSYMSMTLSMPMGSAR | |
PSQ00221 | FD00302 | Minor fimbrium tip subunit Mfa3 | B2RHG3 | Bacteria Bacteroidetes Bacteroidia Bacteroidales Porphyromonadaceae Porphyromonas | Porphyromonas gingivalis (strain ATCC 33277 , 12257 | 23 | None | 446 | None | mfa3 | 431947 | cell outer membrane, pilus, pilus tip | pathogenesis | 24118823 | 23 | 21:43 | CDRGVDPQPDPLQPDVYLLVNAR | |
PSQ00222 | FND00337 | Minor fimbrium tip subunit MfA4 | B2RHG4 | Bacteria Bacteroidetes Bacteroidia Bacteroidales Porphyromonadaceae Porphyromonas | Porphyromonas gingivalis (strain ATCC 33277 , 12257 | 35 | None | 333 | Immunoreactive 32 kDa antigen | None | 431947 | cell outer membrane, pilus | pathogenesis | 26437277, 26972441 | 35 | 19:53 | CSKNNPSEPVEDRSIEISIRVDDFTKTGETVRYER | |
PSQ00223 | FND00012 | Drosulfakinins | B2ZB95 | Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Diptera Brachycera Muscomorpha Ephydroidea Drosophilidae Drosophila Sophophora | Drosophila erecta (Fruit fly) | 42, 26 | neuropeptide hormone activity, neuropeptide receptor binding | 141 | None | Dsk | 7220 | extracellular region | adult feeding behavior, adult locomotory behavior, larval locomotory behavior, multicellular organismal response to stress, neuromuscular junction development, neuropeptide signaling pathway, positive regulation of cytosolic calcium ion concentration, regulation of smooth muscle contraction, smooth muscle contraction | 17632121;17632121 | 68 | 32:73, 86:111 | QTTSLQISKEDRRLQELESKMGAESEQPNANLVGPSISRFGD, VPLISRPMIPIELDLLMDNDDERTKA | |
PSQ00224 | FND00012 | Drosulfakinins | B2ZB96 | Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Diptera Brachycera Muscomorpha Ephydroidea Drosophilidae Drosophila Sophophora | Drosophila mauritiana (Fruit fly) | 40, 26 | hormone activity | 141 | None | Dsk | 7226 | extracellular region | neuropeptide signaling pathway, smooth muscle contraction | 17632121;17632121 | 66 | 34:73, 86:111 | TSLQNAKDDRRLQELESKIGAESDQPNANLVGPSFSRFGD, VPLISRPMIPIELDLLMDNDDERTKA | |
PSQ00225 | FND00012 | Drosulfakinins | B2ZB98 | Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Diptera Brachycera Muscomorpha Ephydroidea Drosophilidae Drosophila Sophophora | Drosophila sechellia (Fruit fly) | 40, 26 | neuropeptide hormone activity, neuropeptide receptor binding | 141 | None | Dsk | 7238 | extracellular region | adult feeding behavior, adult locomotory behavior, larval locomotory behavior, multicellular organismal response to stress, neuromuscular junction development, neuropeptide signaling pathway, positive regulation of cytosolic calcium ion concentration, regulation of smooth muscle contraction, smooth muscle contraction | 17632121;17632121 | 66 | 34:73, 86:111 | TSLQNAKDDRRLQELESKIGAESDQPNANLVGPSFSRFGD, VPLISRPMIPIELDLLMDNDDERTKA | |
PSQ00226 | FND00012 | Drosulfakinins | B2ZB99 | Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Diptera Brachycera Muscomorpha Ephydroidea Drosophilidae Drosophila Sophophora | Drosophila simulans (Fruit fly) | 42, 26 | neuropeptide hormone activity, neuropeptide receptor binding | 141 | None | Dsk | 7240 | extracellular region | adult feeding behavior, adult locomotory behavior, larval locomotory behavior, multicellular organismal response to stress, neuromuscular junction development, neuropeptide signaling pathway, positive regulation of cytosolic calcium ion concentration, regulation of smooth muscle contraction, smooth muscle contraction | 17632121;17632121 | 68 | 32:73, 86:111 | QTTSLQNAKDDRRLQELESKIGAESDQTNANLVGPSFSRFGD, VPLISRPMIPIELDLLMDNDDERTKA | |
PSQ00227 | FND00012 | Drosulfakinins | B2ZBA0 | Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Diptera Brachycera Muscomorpha Ephydroidea Drosophilidae Drosophila Sophophora | Drosophila teissieri (Fruit fly) | 40, 23 | hormone activity | 138 | None | Dsk | 7243 | extracellular region | neuropeptide signaling pathway, smooth muscle contraction | 17632121;17632121 | 63 | 34:73, 86:108 | TSLQISKGDRRLQDLESNMGAESDQPNANLVGTSLSRFGD, VPRPIIPIELDLLMDNDDENTKA | |
PSQ00228 | FND00012 | Drosulfakinins | B2ZBA1 | Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Diptera Brachycera Muscomorpha Ephydroidea Drosophilidae Drosophila Sophophora | Drosophila yakuba (Fruit fly) | 43, 23 | hormone activity | 137 | None | Dsk | 7245 | extracellular region | neuropeptide signaling pathway, smooth muscle contraction | 17632121;17632121 | 66 | 32:74, 85:107 | QTNLQTSKGDRRLQDLESNMGAESDQPNANLVRPSLSRFGDKR, VPRPMIPIELDLLMDNDDENTKA | |
PSQ00229 | FD00044 | Latartoxin-1a | B3EWF2 | Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Araneomorphae Entelegynae Entelegynae incertae sedis Zodariidae Lachesana | Lachesana tarabaevi (Spider) | 6 | toxin activity | 85 | None | None | 379576 | extracellular region | None | 23088912 | 6 | 20:25 | ADEEAR | |
PSQ00230 | FD00133 | Latartoxin-1b | B3EWF3 | Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Araneomorphae Entelegynae Entelegynae incertae sedis Zodariidae Lachesana | Lachesana tarabaevi (Spider) | 7 | toxin activity | 86 | None | None | 379576 | extracellular region | None | 23088912 | 7 | 20:26 | ADSEEVR | |
PSQ00231 | FND00057 | Latartoxin-2a | B3EWF4 | Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Araneomorphae Entelegynae Entelegynae incertae sedis Zodariidae Lachesana | Lachesana tarabaevi (Spider) | 18 | toxin activity | 109 | None | None | 379576 | extracellular region | None | 23088912 | 18 | 20:37 | KKIENFESYIEDLKSEAR | |
PSQ00232 | FND00057 | Latartoxin-2b | B3EWF5 | Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Araneomorphae Entelegynae Entelegynae incertae sedis Zodariidae Lachesana | Lachesana tarabaevi (Spider) | 24 | toxin activity | 118 | None | None | 379576 | extracellular region | None | 23088912 | 24 | 20:43 | EDKYESFESYVEDLKSGNMKGEAR | |
PSQ00233 | FND00270 | Latartoxin-2c | B3EWF6 | Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Araneomorphae Entelegynae Entelegynae incertae sedis Zodariidae Lachesana | Lachesana tarabaevi (Spider) | 23 | toxin activity | 108 | None | None | 379576 | extracellular region | None | 23088912 | 23 | 20:42 | EDTYEDLQNYIENLINENQDEAR | |
PSQ00234 | FD00034 | Cyclotide phyb-A | B3EWH5 | Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae asterids lamiids Solanales Solanaceae Petunioideae Petunia | Petunia hybrida (Petunia) | 43, 6 | None | 79 | None | None | 4102 | None | defense response | 22700981;22700981 | 49 | 1:43, 74:79 | MVGVNSLRSALYLIVLILFVQLTYFSDARVMDVDLSRAFLPLT, GIIPKK | |
PSQ00235 | FND00154 | Acyclotide phyb-K | B3EWH6 | Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae asterids lamiids Solanales Solanaceae Petunioideae Petunia | Petunia hybrida (Petunia) | 19 | None | 74 | None | None | 4102 | None | defense response | 22700981 | 19 | 25:43 | IPETRVMAVELSRVFLQTS | |
PSQ00236 | FD00044 | Toxin CSTX-8 | B3EWS5 | Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Araneomorphae Entelegynae Lycosoidea Ctenidae Cupiennius | Cupiennius salei (American wandering spider) | 27, 6 | toxin activity | 120 | None | None | 6928 | extracellular region | None | 22672445;22672445 | 33 | 21:47, 82:87 | ETEDDFLEDESFQADDVIPFLASEQVR, RSETDR | |
PSQ00237 | FD00044 | Toxin CSTX-12 | B3EWS6 | Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Araneomorphae Entelegynae Lycosoidea Ctenidae Cupiennius | Cupiennius salei (American wandering spider) | 27, 6 | toxin activity | 120 | None | None | 6928 | extracellular region | None | 22672445;22672445 | 33 | 21:47, 82:87 | ETEDDFLEDESFEADDVIPFLAREQVR, RSDTAR | |
PSQ00238 | FD00044 | Toxin CSTX-10 | B3EWT0 | Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Araneomorphae Entelegynae Lycosoidea Ctenidae Cupiennius | Cupiennius salei (American wandering spider) | 27 | toxin activity | 120 | None | None | 6928 | extracellular region | None | 22672445 | 27 | 21:47 | ETDEDFFGEESFEADDIIPFIAKEQVR | |
PSQ00239 | FD00035 | U1-theraphotoxin-Ap1a | B3EWY4 | Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Theraphosidae Acanthoscurria | Acanthoscurria paulensis (Brazilian giant black tarantula spider) | 27 | toxin activity | 98 | None | None | 1264770 | extracellular region | pathogenesis | 23496776 | 27 | 24:50 | EELEVQDGHLMNPGDGDTALATVDDER | |
PSQ00240 | FD00019 | Omega-theraphotoxin-Bs2a | B3FIV1 | Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Theraphosidae Brachypelma | Brachypelma smithi (Mexican red knee tarantula) (Eurypelma smithi) | 35 | sodium channel inhibitor activity, toxin activity | 99 | Brachypelma smithi toxin 1 | None | 54074 | extracellular region | None | 18687374 | 35 | 23:57 | DEDSAETSLLRKLEEAEAAMFGQYLEESKNSREKR | |
PSQ00241 | FND00262 | Precursor of CEP6 | B3H5A9 | Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis | Arabidopsis thaliana (Mouse-ear cress) | 22, 14, 9 | hormone activity | 101 | None | CEP6 | 3702 | apoplast, extracellular region | cellular response to nitrogen starvation, nitrate import, regulation of leaf morphogenesis, regulation of root development, root development | 25324386;25324386;25324386 | 45 | 27:48, 64:77, 93:101 | RQLRKTDDQDHDDHHFTVGYTD, KMKENEENAGGYKD, AVKNNEPNA | |
PSQ00242 | FND00078 | Temporin-SHb | B3KYH5 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Ranoidea Ranidae Pelophylax | Pelophylax saharicus (Sahara frog) (Rana saharica) | 25 | None | 50 | Temporin-1Sb | None | 70019 | extracellular region | None | 18584916 | 25 | 11:35 | EQERDADEEERRDEPDESDVEVEKR | |
PSQ00243 | FD00002 | Temporin-SHc | B3KYH6 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Ranoidea Ranidae Pelophylax | Pelophylax saharicus (Sahara frog) (Rana saharica) | 25 | None | 50 | Temporin-1Sc | None | 70019 | extracellular region, membrane, other organism cell membrane | defense response to bacterium, defense response to fungus, innate immune response, killing of cells of other organism | 18584916 | 25 | 11:35 | EQERDADEEERRDEPDGSNVEVEKR | |
PSQ00244 | FD00002 | Brevinin-1CDYa | B3VZU0 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Ranoidea Ranidae Rana Rana | Rana dybowskii (Dybovsky | 23 | None | 67 | None | None | 71582 | extracellular region | defense response to Gram-negative bacterium, defense response to Gram-positive bacterium, hemolysis in other organism | 19539775 | 23 | 23:45 | EEERNADEEERRDDLEERDVEVE | |
PSQ00245 | FND00365 | Conotoxin ca17a | B4YSU8 | Eukaryota Metazoa Spiralia Lophotrochozoa Mollusca Gastropoda Caenogastropoda Neogastropoda Conoidea Conidae Conus | Conus caracteristicus (Characteristic cone) | 20 | toxin activity | 74 | Conotoxin ca16a | None | 89440 | extracellular region | None | 18584917 | 20 | 21:40 | QDAEGSQEDAAQREVDIATR | |
PSQ00246 | FND00001 | Dybowskin-1CDYa | B5A9S9 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Ranoidea Ranidae Rana Rana | Rana dybowskii (Dybovsky | 22 | None | 60 | None | None | 71582 | extracellular region | defense response to Gram-negative bacterium, defense response to Gram-positive bacterium | 19539775 | 22 | 23:44 | EEERNAEEERRDYPEERDVEVE | |
PSQ00247 | FND00266 | Preprofallaxidin-2 | B5LUQ3 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Hyloidea Hylidae Pelodryadinae Litoria | Litoria fallax (Eastern dwarf tree frog) (Hylomantis fallax) | 27 | None | 91 | None | None | 115422 | extracellular region | defense response to Gram-positive bacterium | 18803332 | 27 | 23:49 | EKEKRENEGNENEEEEENHEEGSEEKR | |
PSQ00248 | FD00002 | Preprofallaxidin-1 | B5LUQ4 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Hyloidea Hylidae Pelodryadinae Litoria | Litoria fallax (Eastern dwarf tree frog) (Hylomantis fallax) | 24 | None | 67 | None | None | 115422 | extracellular region | defense response to bacterium, defense response to Gram-positive bacterium, negative regulation of nitric-oxide synthase activity | 18803332 | 24 | 23:46 | DKEKREGENEEEEEEHEEESEEKR | |
PSQ00249 | FD00002 | Preprofallaxidin-4 | B5LUQ5 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Hyloidea Hylidae Pelodryadinae Litoria | Litoria fallax (Eastern dwarf tree frog) (Hylomantis fallax) | 24 | None | 67 | None | None | 115422 | extracellular region | defense response | 18803332 | 24 | 23:46 | DKEKREGENEEEEEEHEEESEEKR | |
PSQ00250 | FD00002 | Preprofallaxidin-5 | B5LUQ6 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Hyloidea Hylidae Pelodryadinae Litoria | Litoria fallax (Eastern dwarf tree frog) (Hylomantis fallax) | 29 | None | 68 | None | None | 115422 | extracellular region | defense response | 18803332 | 29 | 23:51 | EEEKREDKEDEGENEEAEENHEERSEEKR |