Proseq ID | Family | Protein Name ![]() |
Uniprot ID | Taxonomy | Organism | Prosequence length![]() |
Functions | Preproprotein length | Alter Name | Gene Name | NCBI ID | Cell Org | Process | PubMed | Total Proseq length | Proseq Loc | Prosequence Sequence | |
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
PSQ00401 | FD00001 | Omega-theraphotoxin-Hhn1f 4 | D2Y2F0 | Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Theraphosidae Haplopelma | Cyriopagopus hainanus (Chinese bird spider) (Haplopelma hainanum) | 29 | ion channel inhibitor activity, toxin activity | 86 | Hainantoxin-IX, Peptide F1-29 | None | 209901 | extracellular region | pathogenesis | 20192277 | 29 | 22:50 | SEDAHKELLKEVVRAMVVDKTDAVQAGER | |
PSQ00402 | FD00001 | U3-theraphotoxin-Hhn1a 8 | D2Y2G3 | Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Theraphosidae Haplopelma | Cyriopagopus hainanus (Chinese bird spider) (Haplopelma hainanum) | 28 | ion channel inhibitor activity, toxin activity | 87 | Hainantoxin-VIII, Peptide F4-27 | None | 209901 | extracellular region | pathogenesis | 20192277 | 28 | 25:52 | SGSEEKEFPKEMLSSIFAVDNDFKQEER | |
PSQ00403 | FD00001 | U3-theraphotoxin-Hhn1a 9 | D2Y2G4 | Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Theraphosidae Haplopelma | Cyriopagopus hainanus (Chinese bird spider) (Haplopelma hainanum) | 28 | ion channel inhibitor activity, toxin activity | 87 | Hainantoxin-VIII, Peptide F4-27 | None | 209901 | extracellular region | pathogenesis | 20192277 | 28 | 25:52 | SESEEKEFPKEMLSSIFAVDNDFKQEER | |
PSQ00404 | FD00001 | U3-theraphotoxin-Hhn1a 10 | D2Y2G5 | Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Theraphosidae Haplopelma | Cyriopagopus hainanus (Chinese bird spider) (Haplopelma hainanum) | 28 | ion channel inhibitor activity, toxin activity | 87 | Hainantoxin-VIII, Peptide F4-27 | None | 209901 | extracellular region | pathogenesis | 20192277 | 28 | 25:52 | SESEEKEFPKEMLSSIFAVDNDFKQEER | |
PSQ00405 | FD00001 | U3-theraphotoxin-Hhn1a 11 | D2Y2G6 | Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Theraphosidae Haplopelma | Cyriopagopus hainanus (Chinese bird spider) (Haplopelma hainanum) | 28 | ion channel inhibitor activity, toxin activity | 87 | Hainantoxin-VIII, Peptide F4-27 | None | 209901 | extracellular region | pathogenesis | 20192277 | 28 | 25:52 | SESEKKEFPKEMLSSIFAVDNDFKQEER | |
PSQ00406 | FD00019 | U11-theraphotoxin-Hhn1a | D2Y2I1 | Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Theraphosidae Haplopelma | Cyriopagopus hainanus (Chinese bird spider) (Haplopelma hainanum) | 53 | sodium channel inhibitor activity, toxin activity | 120 | Hainantoxin-XVI, Peptide F4-19 | None | 209901 | extracellular region | None | 20192277 | 53 | 22:74 | DKDENRMEMQEKTEQGNSYLDFAENLPLQKLEELEAKLLEEDSEESRNSRQKR | |
PSQ00407 | FND00002 | U11-theraphotoxin-Hhn1a | D2Y2I2 | Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Theraphosidae Haplopelma | Cyriopagopus hainanus (Chinese bird spider) (Haplopelma hainanum) | 53 | sodium channel inhibitor activity, toxin activity | 120 | Hainantoxin-XVI, Peptide F4-19 | None | 209901 | extracellular region | None | 20192277 | 53 | 22:74 | DKDENRMEMQEKTEQGNSYLDFAENLLLQKLEELEAKLLEEDSEESRNSRQKR | |
PSQ00408 | FD00001 | Hainantoxin-III 12 | D2Y2I3 | Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Theraphosidae Haplopelma | Cyriopagopus hainanus (Chinese bird spider) (Haplopelma hainanum) | 27 | ion channel inhibitor activity, toxin activity | 83 | Hainantoxin-3, Mu-theraphotoxin-Hhn2a, Peptide F7-18 | None | 209901 | extracellular region | pathogenesis | 14512091, 20192277 | 27 | 22:48 | SGSEEKEFPRELLSKIFAVDDFKGEER | |
PSQ00409 | FND00003 | U4-theraphotoxin-Hhn1a | D2Y2I9 | Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Theraphosidae Haplopelma | Cyriopagopus hainanus (Chinese bird spider) (Haplopelma hainanum) | 26 | toxin activity | 85 | Hainantoxin-II, Peptide F8-20 | None | 209901 | extracellular region, host cell postsynaptic membrane | pathogenesis | 20192277, 21174344 | 26 | 23:48 | EELEAESQLMEVGMPDTELEAVDEER | |
PSQ00410 | FND00003 | U4-theraphotoxin-Hhn1a | D2Y2K5 | Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Theraphosidae Haplopelma | Cyriopagopus hainanus (Chinese bird spider) (Haplopelma hainanum) | 26 | toxin activity | 85 | Hainantoxin-II, Peptide F8-20 | None | 209901 | extracellular region, host cell postsynaptic membrane | pathogenesis | 20192277, 21174344 | 26 | 23:48 | EELEAESQLMEVGMPDTELAAVDEER | |
PSQ00411 | FND00003 | U4-theraphotoxin-Hhn1a | D2Y2K7 | Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Theraphosidae Haplopelma | Cyriopagopus hainanus (Chinese bird spider) (Haplopelma hainanum) | 26 | toxin activity | 85 | Hainantoxin-II, Peptide F8-20 | None | 209901 | extracellular region, host cell postsynaptic membrane | pathogenesis | 20192277, 21174344 | 26 | 23:48 | EELEAESQLMEVGMPDTELAAVDEER | |
PSQ00412 | FND00003 | U4-theraphotoxin-Hhn1a | D2Y2K8 | Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Theraphosidae Haplopelma | Cyriopagopus hainanus (Chinese bird spider) (Haplopelma hainanum) | 26 | toxin activity | 85 | Hainantoxin-II, Peptide F8-20 | None | 209901 | extracellular region, host cell postsynaptic membrane | pathogenesis | 20192277, 21174344 | 26 | 23:48 | EELEAESQLMEVGMPDTELAAVDEER | |
PSQ00413 | FND00003 | U4-theraphotoxin-Hhn1a | D2Y2K9 | Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Theraphosidae Haplopelma | Cyriopagopus hainanus (Chinese bird spider) (Haplopelma hainanum) | 26 | toxin activity | 85 | Hainantoxin-II, Peptide F8-20 | None | 209901 | extracellular region, host cell postsynaptic membrane | pathogenesis | 20192277, 21174344 | 26 | 23:48 | EELEAESQLMEVGMPDTELAAVDEER | |
PSQ00414 | FND00003 | U4-theraphotoxin-Hhn1a | D2Y2L2 | Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Theraphosidae Haplopelma | Cyriopagopus hainanus (Chinese bird spider) (Haplopelma hainanum) | 26 | toxin activity | 85 | Hainantoxin-II, Peptide F8-20 | None | 209901 | extracellular region, host cell postsynaptic membrane | pathogenesis | 20192277, 21174344 | 26 | 23:48 | EELEAESQLMEVGMPDTELAAVDEER | |
PSQ00415 | FND00003 | U4-theraphotoxin-Hhn1a | D2Y2L3 | Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Theraphosidae Haplopelma | Cyriopagopus hainanus (Chinese bird spider) (Haplopelma hainanum) | 26 | toxin activity | 85 | Hainantoxin-II, Peptide F8-20 | None | 209901 | extracellular region, host cell postsynaptic membrane | pathogenesis | 20192277, 21174344 | 26 | 23:48 | EELEAESQLMEIGMPDTELEAVDEER | |
PSQ00416 | FD00001 | Omega-theraphotoxin-Hhn1a 3 | D2Y2L7 | Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Theraphosidae Haplopelma | Cyriopagopus hainanus (Chinese bird spider) (Haplopelma hainanum) | 29 | ion channel inhibitor activity, toxin activity | 86 | Hainantoxin-IX-2, Peptide F1-30 | None | 209901 | extracellular region | pathogenesis | 20192277 | 29 | 22:50 | SEDAHKELLKEVVGAMVVDTTDAVQAEER | |
PSQ00417 | FD00001 | U3-theraphotoxin-Hhn1a 12 | D2Y2M1 | Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Theraphosidae Haplopelma | Cyriopagopus hainanus (Chinese bird spider) (Haplopelma hainanum) | 28 | ion channel inhibitor activity, toxin activity | 87 | Hainantoxin-VIII, Peptide F4-27 | None | 209901 | extracellular region | pathogenesis | 20192277 | 28 | 25:52 | SESEEKEFPKEMLSSIFAVDKDFKQEER | |
PSQ00418 | FD00001 | U3-theraphotoxin-Hhn1a 13 | D2Y2M4 | Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Theraphosidae Haplopelma | Cyriopagopus hainanus (Chinese bird spider) (Haplopelma hainanum) | 28 | ion channel inhibitor activity, toxin activity | 87 | Hainantoxin-VIII, Peptide F4-27 | None | 209901 | extracellular region | pathogenesis | 20192277 | 28 | 25:52 | SESEEKEFPKEMLSSIFAVDNDFKQEER | |
PSQ00419 | FD00001 | U3-theraphotoxin-Hhn1a 14 | D2Y2M5 | Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Theraphosidae Haplopelma | Cyriopagopus hainanus (Chinese bird spider) (Haplopelma hainanum) | 28 | ion channel inhibitor activity, toxin activity | 87 | Hainantoxin-VIII, Peptide F4-27 | None | 209901 | extracellular region | pathogenesis | 20192277 | 28 | 25:52 | SESEEKEFPKEMLSSIFAVDNDFKQEER | |
PSQ00420 | FD00001 | U3-theraphotoxin-Hhn1a 15 | D2Y2M6 | Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Theraphosidae Haplopelma | Cyriopagopus hainanus (Chinese bird spider) (Haplopelma hainanum) | 28 | ion channel inhibitor activity, toxin activity | 87 | Hainantoxin-VIII, Peptide F4-27 | None | 209901 | extracellular region | pathogenesis | 20192277 | 28 | 25:52 | SESEEKEFPKEMLSSIFAVDNDFKQEER | |
PSQ00421 | FD00001 | U3-theraphotoxin-Hhn1a 16 | D2Y2M8 | Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Theraphosidae Haplopelma | Cyriopagopus hainanus (Chinese bird spider) (Haplopelma hainanum) | 28 | ion channel inhibitor activity, toxin activity | 87 | Hainantoxin-VIII, Peptide F4-27 | None | 209901 | extracellular region | pathogenesis | 20192277 | 28 | 25:52 | SESEEKEFPKEMLSSIFAVDNDFKQGER | |
PSQ00422 | FD00001 | U3-theraphotoxin-Hhn1a 17 | D2Y2N0 | Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Theraphosidae Haplopelma | Cyriopagopus hainanus (Chinese bird spider) (Haplopelma hainanum) | 28 | ion channel inhibitor activity, toxin activity | 87 | Hainantoxin-VIII, Peptide F4-27 | None | 209901 | extracellular region | pathogenesis | 20192277 | 28 | 25:52 | SESEEKEFPKEMLSSIFAVDNDFKQEER | |
PSQ00423 | FD00001 | U3-theraphotoxin-Hhn1a 18 | D2Y2N1 | Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Theraphosidae Haplopelma | Cyriopagopus hainanus (Chinese bird spider) (Haplopelma hainanum) | 28 | ion channel inhibitor activity, toxin activity | 87 | Hainantoxin-VIII, Peptide F4-27 | None | 209901 | extracellular region | pathogenesis | 20192277 | 28 | 25:52 | SESEEKEFPKEMLSSIFAVDNDFKQEER | |
PSQ00424 | FD00001 | U3-theraphotoxin-Hhn1a 19 | D2Y2N4 | Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Theraphosidae Haplopelma | Cyriopagopus hainanus (Chinese bird spider) (Haplopelma hainanum) | 28 | ion channel inhibitor activity, toxin activity | 87 | Hainantoxin-VIII, Peptide F4-27 | None | 209901 | extracellular region | pathogenesis | 20192277 | 28 | 25:52 | SESEEKEFPKEMLSSIFAVDNDFKQEER | |
PSQ00425 | FND00042 | Hainantoxin-XVIII | D2Y2P2 | Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Theraphosidae Haplopelma | Cyriopagopus hainanus (Chinese bird spider) (Haplopelma hainanum) | 28 | toxin activity | 109 | Peptide F7-35 | None | 209901 | extracellular region | None | 20192277 | 28 | 19:46 | FPSKDSKAIENDKTEQRMEIVVQETARA | |
PSQ00426 | FND00002 | U11-theraphotoxin-Hhn1a | D2Y2P3 | Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Theraphosidae Haplopelma | Cyriopagopus hainanus (Chinese bird spider) (Haplopelma hainanum) | 53 | sodium channel inhibitor activity, toxin activity | 120 | Hainantoxin-XVI, Peptide F4-19 | None | 209901 | extracellular region | None | 20192277 | 53 | 22:74 | DKDENRMEMQEKTEQGKSYLDFAENLLLQKLEELEAKLLEEDSEESRNSRQKR | |
PSQ00427 | FD00019 | U11-theraphotoxin-Hhn1a | D2Y2P6 | Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Theraphosidae Haplopelma | Cyriopagopus hainanus (Chinese bird spider) (Haplopelma hainanum) | 53 | sodium channel inhibitor activity, toxin activity | 120 | Hainantoxin-XVI, Peptide F4-19 | None | 209901 | extracellular region | None | 20192277 | 53 | 22:74 | DKDENRMEMQEKTEQGKSYLDFAENLLLQKLEEPEAKLLEEDSEESRNSRQKR | |
PSQ00428 | FD00352 | Plantazolicin | D3VML5 | Bacteria Firmicutes Bacilli Bacillales Bacillaceae Bacillus Bacillus amyloliquefaciens group | Bacillus velezensis (strain DSM 23117 , amyloliquefaciens subsp | 27 | None | 41 | Plantazolicin A , Plantazolicin B , cpd1335 | pznA | 326423 | extracellular region, Gram-positive-bacterium-type cell wall | cytolysis by symbiont of host cells, defense response to Gram-positive bacterium | 20971906, 21950656 | 27 | 1:27 | MTQIKVPTALIASVHGEGQHLFEPMAA | |
PSQ00429 | FD00130 | Augurin | D4A540 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Glires Rodentia Myomorpha Muroidea Muridae Murinae Rattus | Rattus norvegicus (Rat) | 37 | None | 148 | Esophageal cancer-related gene 4 protein homolog | Ecrg4 | 10116 | apical plasma membrane, cytoplasm, dense core granule, extracellular space | anaphase-promoting complex-dependent catabolic process, cellular senescence, central nervous system development, G1 to G0 transition, negative regulation of cell population proliferation, regulation of cell population proliferation, response to wounding | 26479776 | 37 | 32:68 | NKLKKMLQKREGPVPSKTNVAVSEHTAKEFLGGLKRA | |
PSQ00430 | FD00154 | Proteasome subunit beta | D4GYZ1 | Archaea Euryarchaeota Stenosarchaea group Halobacteria Haloferacales Haloferacaceae Haloferax | Haloferax volcanii (strain ATCC 29605 , NCIMB 2012 | 49 | endopeptidase activity, threonine-type endopeptidase activity | 243 | 20S proteasome beta subunit , Proteasome core protein PsmB | psmB | 309800 | cytoplasm, proteasome core complex, beta-subunit complex | proteasomal protein catabolic process | 10482525 | 49 | 1:49 | MRTPTHDEFSGRLDSLNGDRSNVFGPELGEFSNADRRADELGDKETKTG | |
PSQ00431 | FD00033 | Alpha-conotoxin EIIA | D4HRK4 | Eukaryota Metazoa Spiralia Lophotrochozoa Mollusca Gastropoda Caenogastropoda Neogastropoda Conoidea Conidae Conus Chelyconus | Conus ermineus (Atlantic fish-hunting cone) | 24 | acetylcholine receptor inhibitor activity, toxin activity | 61 | None | None | 55423 | extracellular region, host cell postsynaptic membrane | pathogenesis | 23584713, 28238803 | 24 | 17:40 | FTLDRVLEGRNAAAIDNALDQRDP | |
PSQ00432 | FND00250 | Alpha-conotoxin-like Kn1 | D4HRK7 | Eukaryota Metazoa Spiralia Lophotrochozoa Mollusca Gastropoda Caenogastropoda Neogastropoda Conoidea Conidae Conus Afonsoconus | Conus kinoshitai (Kinoshita | 22 | acetylcholine receptor inhibitor activity, toxin activity | 37 | None | None | 376876 | extracellular region, host cell postsynaptic membrane | pathogenesis | 26948522 | 22 | 1:22 | ESDGAHAKARADKPARSATNRQ | |
PSQ00433 | FD00002 | Temporin-SHd | D4YWD0 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Ranoidea Ranidae Pelophylax | Pelophylax saharicus (Sahara frog) (Rana saharica) | 24 | None | 60 | Temporin-1Sd | None | 70019 | extracellular region, membrane, other organism cell membrane | defense response to bacterium, defense response to fungus, hemolysis in other organism, innate immune response | 20308076 | 24 | 11:34 | EQERDADEEKRDEPDESDVEVEKR | |
PSQ00434 | FND00078 | Temporin-SHf | D4YWD1 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Ranoidea Ranidae Pelophylax | Pelophylax saharicus (Sahara frog) (Rana saharica) | 25 | None | 45 | Phe-rich antimicrobial peptide | None | 70019 | extracellular region, membrane, other organism cell membrane | defense response to bacterium, hemolysis in other organism, innate immune response | 20308076 | 25 | 11:35 | EEERDADEEERRDEPDESNVEVKKR | |
PSQ00435 | FND00001 | Temporin-SHe | D5GRW4 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Ranoidea Ranidae Pelophylax | Pelophylax saharicus (Sahara frog) (Rana saharica) | 24 | None | 64 | None | None | 70019 | extracellular region, membrane, other organism cell membrane | defense response to bacterium, defense response to fungus, hemolysis in other organism, innate immune response | 20308076 | 24 | 23:46 | EQERDAEEERRDGTDESDVEVEKR | |
PSQ00436 | FD00001 | Omega-theraphotoxin-Pm1a | D5J6X1 | Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Theraphosidae Pelinobius | Pelinobius muticus (King baboon spider) (Citharischius crawshayi) | 24 | ion channel inhibitor activity, toxin activity | 84 | Omega-theraphotoxin-Cc1a , Toxin-like GVDKE | None | 753628 | extracellular region | pathogenesis | 20372963 | 24 | 22:45 | TEERAHPNELVNSLVELVKLDAER | |
PSQ00437 | FD00013 | Zinc metalloproteinase-disintegrin-like atrase-B | D6PXE8 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Lepidosauria Squamata Bifurcata Unidentata Episquamata Toxicofera Serpentes Colubroidea Elapidae Elapinae Naja | Naja atra (Chinese cobra) | 171 | metal ion binding, metalloendopeptidase activity, toxin activity | 600 | Snake venom metalloproteinase | None | 8656 | extracellular region | None | 20837040 | 171 | 21:191 | IILESGNVNDYEVVYPQKVPALLKGGVQNPQPETKYEDTMRYEFQVNGEPVVLHLERNKGLFSEDYTETHYAPDGREITTSPPVQDHCYYHGYIQNEADSSAVISACDGLKGHFEHQGETYFIEPLKISNSEAHAIYKDENVENEDETPEICGVTETTWESDESIEKTSQL | |
PSQ00438 | FD00539 | Beta-agarase C | D7GXG5 | Bacteria Bacteroidetes Flavobacteriia Flavobacteriales Flavobacteriaceae Zobellia | Zobellia galactanivorans (strain DSM 12802 , NCIMB 13871 | 50 | beta-agarase activity | 328 | None | agaC | 63186 | extracellular region | carbohydrate metabolic process | 15456406 | 50 | 18:67 | CKNDIDTELEKKSIPESEIQKSEEKLPNEEELTPTDPDEETNKEETVTAN | |
PSQ00439 | FD00349 | Natriuretic peptide Na-NP | D9IX97 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Lepidosauria Squamata Bifurcata Unidentata Episquamata Toxicofera Serpentes Colubroidea Elapidae Elapinae Naja | Naja atra (Chinese cobra) | 58 | hormone activity, toxin activity | 165 | None | None | 8656 | extracellular region | envenomation resulting in vasodilation in other organism, regulation of blood pressure, vasodilation | 21050868 | 58 | 26:83 | KPAPEALHKPPTGLRTSLAALRILGYLRPDSKQSRAARDRMLHPEQQVGGGGDSRPLQ | |
PSQ00440 | FD00036 | Lantibiotic nukacin | E0WX65 | Bacteria Firmicutes Bacilli Bacillales Staphylococcaceae Staphylococcus | Staphylococcus simulans | 30 | signaling receptor binding | 60 | Nukacin 3299 , Simulancin 3299 | nukA | 1286 | extracellular region | cytolysis, defense response to bacterium | 20627619 | 30 | 1:30 | MENSKVMKDIEVANLLEEVQEDELNEVLGA | |
PSQ00441 | FD00007 | Beta-fibrinogenase | E0Y419 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Lepidosauria Squamata Bifurcata Unidentata Episquamata Toxicofera Serpentes Colubroidea Viperidae Viperinae Macrovipera | Macrovipera lebetina (Levantine viper) (Vipera lebetina) | 6 | serine-type endopeptidase activity, toxin activity | 257 | Snake venom serine protease | None | 8709 | extracellular region | None | 11602278 | 6 | 19:24 | QKSSEL | |
PSQ00442 | FD00032 | Brevinin-1CG3 | E1AWD2 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Ranoidea Ranidae Amolops | Amolops chunganensis (Chungan torrent frog) (Hylorana chunganensis) | 22 | None | 70 | None | None | 325556 | extracellular region | defense response to bacterium, defense response to fungus, hemolysis in other organism | 22951323 | 22 | 23:44 | EQERNAEEERRDDSDKRDVEVE | |
PSQ00443 | FD00032 | Brevinin-1CG4 | E1AWD3 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Ranoidea Ranidae Amolops | Amolops chunganensis (Chungan torrent frog) (Hylorana chunganensis) | 23 | None | 71 | None | None | 325556 | extracellular region | defense response to bacterium, defense response to fungus, hemolysis in other organism | 22951323 | 23 | 23:45 | EQERNADEEERRDDSDKRDVEVE | |
PSQ00444 | FD00113 | Brevinin-1CG1 | E1AWD4 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Ranoidea Ranidae Amolops | Amolops chunganensis (Chungan torrent frog) (Hylorana chunganensis) | 21 | None | 69 | None | None | 325556 | extracellular region | defense response to bacterium, defense response to fungus, hemolysis in other organism | 22951323 | 21 | 23:43 | EQERNAEEERRDDDEMDVEVE | |
PSQ00445 | FD00032 | Brevinin-1CG2 | E1AWD5 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Ranoidea Ranidae Amolops | Amolops chunganensis (Chungan torrent frog) (Hylorana chunganensis) | 21 | None | 69 | None | None | 325556 | extracellular region | defense response to bacterium, defense response to fungus, hemolysis in other organism | 22951323 | 21 | 23:43 | EQERNAEEERRDDDEMDVEVE | |
PSQ00446 | FD00081 | Brevinin-2CG1 | E1AWD6 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Ranoidea Ranidae Amolops | Amolops chunganensis (Chungan torrent frog) (Hylorana chunganensis) | 17 | None | 74 | None | None | 325556 | extracellular region | defense response to bacterium, defense response to fungus, hemolysis in other organism | 22951323 | 17 | 23:39 | EEERNADEDDGEMTEEV | |
PSQ00447 | FND00001 | Temporin-CG1 | E1AWD7 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Ranoidea Ranidae Amolops | Amolops chunganensis (Chungan torrent frog) (Hylorana chunganensis) | 21 | None | 60 | None | None | 325556 | extracellular region | defense response to bacterium, defense response to fungus, hemolysis in other organism | 22951323 | 21 | 23:43 | EQERNAEEERRDDDERNAEVE | |
PSQ00448 | FD00002 | Temporin-CG2 | E1AWD8 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Ranoidea Ranidae Amolops | Amolops chunganensis (Chungan torrent frog) (Hylorana chunganensis) | 21 | None | 60 | None | None | 325556 | extracellular region | defense response to bacterium, defense response to fungus, hemolysis in other organism | 22951323 | 21 | 23:43 | EQERNAEEERRDDDERNVEVE | |
PSQ00449 | FND00001 | Temporin-CG3 | E1AWE0 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Ranoidea Ranidae Amolops | Amolops chunganensis (Chungan torrent frog) (Hylorana chunganensis) | 22 | None | 61 | None | None | 325556 | extracellular region | defense response to bacterium, defense response to fungus, hemolysis in other organism | 22951323 | 22 | 23:44 | EQERNAEEERRDEPDERNAEVE | |
PSQ00450 | FD00081 | Brevinin-2MT1 | E1AXF5 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Ranoidea Ranidae Amolops | Amolops mantzorum (Sichuan torrent frog) | 17 | None | 74 | None | None | 167930 | extracellular region | defense response to bacterium, defense response to fungus, hemolysis in other organism | 24601776 | 17 | 23:39 | EEERNADEDDGEMTEEE |