Proseq ID | Family | Protein Name ![]() |
Uniprot ID | Taxonomy | Organism | Prosequence length![]() |
Functions | Preproprotein length | Alter Name | Gene Name | NCBI ID | Cell Org | Process | PubMed | Total Proseq length | Proseq Loc | Prosequence Sequence | |
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
PSQ00101 | FND00004 | Dermaseptin-SP5 | A0A5P9K5G4 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Hyloidea Hylidae Phyllomedusinae Agalychnis | Agalychnis spurrelli (Gliding leaf frog) (Agalychnis litodryas) | 23 | None | 75 | None | None | 317303 | extracellular region, membrane, other organism cell membrane | None | 31671555 | 23 | 23:45 | EEEKRENEVEEEQEDDEQSELRR | |
PSQ00102 | FND00004 | Dermaseptin-SP4 | A0A5P9K6A8 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Hyloidea Hylidae Phyllomedusinae Agalychnis | Agalychnis spurrelli (Gliding leaf frog) (Agalychnis litodryas) | 23 | None | 75 | None | None | 317303 | extracellular region, membrane, other organism cell membrane | defense response to bacterium, defense response to fungus, hemolysis in other organism, innate immune response | 31671555 | 23 | 23:45 | EEEKRENEVEEEQEDDEQSELRR | |
PSQ00103 | FND00004 | Dermaseptin-SP3 | A0A5P9K9Z4 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Hyloidea Hylidae Phyllomedusinae Agalychnis | Agalychnis spurrelli (Gliding leaf frog) (Agalychnis litodryas) | 23 | None | 75 | None | None | 317303 | extracellular region, membrane, other organism cell membrane | defense response to bacterium, defense response to fungus, hemolysis in other organism, innate immune response | 31671555 | 23 | 23:45 | EEEKRENEVEEEQEDDEQSELRR | |
PSQ00104 | FND00004 | Dermaseptin-PT9 | A0A5P9NYS6 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Hyloidea Hylidae Phyllomedusinae Phyllomedusa | Phyllomedusa tarsius (Brownbelly leaf frog) (Phyllomedusa tarsia) | 21 | None | 71 | None | None | 306084 | extracellular region, membrane, other organism cell membrane | defense response to bacterium, defense response to fungus, innate immune response, killing of cells of other organism | 31635388 | 21 | 23:43 | EEEKRENEMEQEDDEQSEMKR | |
PSQ00105 | FND00022 | Medusin-AS | A0A5Q0MU22 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Hyloidea Hylidae Phyllomedusinae Agalychnis | Agalychnis spurrelli (Gliding leaf frog) (Agalychnis litodryas) | 27 | None | 68 | None | None | 317303 | extracellular region | defense response to bacterium, defense response to fungus, innate immune response, killing of cells of other organism | 31671555 | 27 | 23:49 | EEEKRESEEEKNEQEEDDRDERSEEKR | |
PSQ00106 | FND00010 | [Ser6, Val10, Asp11]-phyllokinin | A0A5Q0MUM5 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Hyloidea Hylidae Phyllomedusinae Agalychnis | Agalychnis spurrelli (Gliding leaf frog) (Agalychnis litodryas) | 29 | toxin activity | 62 | None | None | 317303 | extracellular region | vasodilation | 31671555 | 29 | 23:51 | EEEKRETEEEENEDDMDEESEEKKRESPD | |
PSQ00107 | FND00010 | [Thr6, Val10, Asp11]-phyllokinin | A0A5Q0MUT1 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Hyloidea Hylidae Phyllomedusinae Agalychnis | Agalychnis spurrelli (Gliding leaf frog) (Agalychnis litodryas) | 28 | toxin activity | 61 | None | None | 317303 | extracellular region | vasodilation | 31671555 | 28 | 23:50 | EEEKRETEEEENEDEMNEESEEKRESPE | |
PSQ00108 | FD00002 | Brevinin-2GHb | A0AEI5 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Ranoidea Ranidae Sylvirana | Sylvirana guentheri (Gunther | 20 | None | 72 | AMP-2 | br2GHb | 110109 | extracellular region | defense response to bacterium | 16979798 | 20 | 23:42 | EQERGADEDDGGEMTEELKR | |
PSQ00109 | FD00002 | Brevinin-2GHc | A0AEI6 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Ranoidea Ranidae Sylvirana | Sylvirana guentheri (Gunther | 20 | None | 72 | AMP-4 | br2GHc | 110109 | extracellular region | defense response to bacterium | 16979798 | 20 | 23:42 | EQERGADEDEGEVEEQIKRS | |
PSQ00110 | FND00019 | Irditoxin subunit A | A0S864 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Lepidosauria Squamata Bifurcata Unidentata Episquamata Toxicofera Serpentes Colubroidea Colubridae Colubrinae Boiga | Boiga irregularis (Brown tree snake) | 15 | acetylcholine receptor inhibitor activity, toxin activity | 109 | None | None | 92519 | extracellular region | modulation of receptor activity in other organism | 18952712 | 15 | 20:34 | DQLGLGRQQIDWGQG | |
PSQ00111 | FND00019 | Irditoxin subunit B | A0S865 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Lepidosauria Squamata Bifurcata Unidentata Episquamata Toxicofera Serpentes Colubroidea Colubridae Colubrinae Boiga | Boiga irregularis (Brown tree snake) | 15 | acetylcholine receptor inhibitor activity, toxin activity | 118 | None | None | 92519 | extracellular region | modulation of receptor activity in other organism | 18952712 | 15 | 20:34 | DQLGLGRQQIDWGKG | |
PSQ00112 | FND00164 | Short neuropeptide F | A0SIF1 | Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Diptera Nematocera Culicoidea Culicidae Anophelinae Anopheles | Anopheles gambiae (African malaria mosquito) | 28 | neuropeptide hormone activity | 240 | None | sNPF | 7165 | extracellular region | neuropeptide signaling pathway, regulation of multicellular organism growth, regulation of response to food | 17140700 | 28 | 207:234 | SDPALAKDSSEDKALDVEESENTNADDK | |
PSQ00113 | FD00113 | Brevinins-ALa | A0SN38 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Ranoidea Ranidae Amolops | Amolops loloensis (Lolokou Sucker Frog) (Staurois loloensis) | 24 | None | 70 | Amolopin-1a , Brevinins-1E-AL1 | None | 318551 | extracellular region | defense response to bacterium, defense response to fungus, hemolysis in other organism, innate immune response | 17000029 | 24 | 23:46 | EQERNADEEERRDDDEMDVEVEKR | |
PSQ00114 | FD00032 | Brevinin-ALb | A0SN42 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Ranoidea Ranidae Amolops | Amolops loloensis (Lolokou Sucker Frog) (Staurois loloensis) | 24 | None | 70 | Amolopin-1b , Brevinin-1E-AL2 | None | 318551 | extracellular region | defense response to bacterium, defense response to fungus, hemolysis in other organism, innate immune response | 17000029 | 24 | 23:46 | EQERDADEEERRDDDEMDVEVEKR | |
PSQ00115 | FND00001 | Temporin-ALa | A0SN45 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Ranoidea Ranidae Amolops | Amolops loloensis (Lolokou Sucker Frog) (Staurois loloensis) | 24 | None | 64 | Amolopin-2a | None | 318551 | extracellular region | defense response to bacterium, defense response to fungus, hemolysis in other organism, innate immune response | 17000029 | 24 | 23:46 | EQERNAEEERRDEPDERNAEVEKR | |
PSQ00116 | FND00258 | Vespid chemotactic peptide 5h | A0SPI1 | Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Hymenoptera Apocrita Aculeata Vespoidea Vespidae Vespinae Vespa | Vespa magnifica (Hornet) | 26 | None | 65 | None | None | 202807 | extracellular region | chemotaxis, defense response to bacterium, defense response to fungus, killing of cells of other organism | 17573088 | 26 | 24:49 | APAASPLANPGASPDAAPNADPLADP | |
PSQ00117 | FD00428 | Alpha-agarase | A1IGV8 | Bacteria Proteobacteria Gammaproteobacteria Alteromonadales Colwelliaceae Thalassotalea | Thalassotalea agarivorans (Thalassomonas agarivorans) | 657 | alpha-agarase activity, calcium ion binding, carbohydrate binding | 1463 | AgaraseA33 | agaA33 | 349064 | None | cell adhesion, polysaccharide catabolic process | 17177517 | 657 | 28:684 | ETTNVEAEGYSTIGGTYQDGNPQPINIYSVNGVQAINFVNRGDFAEYDVSVSTAGEYSIEYLIGTSIASGSAVEISVLVDGNWQSAGSTNVPLGQWDNFQALAANNNISLAQGTNRIKITGAGTHDWQWNLDAFSLTLVTPENPDNPDNPDNPDDGNTGQPGTPFTIEMEAFDATGSDDPRAQGMVIGERGYPEDKHTVVDSNQTTDWVDYNINFPVSGNYRIEMLASGQTSHATAILFVDNVQINEVAVDTGNQAVFLDFELTDSTYISAGAHTIRVQSGSQINEFSWMWFGDALTFTPLDGGSTDGDADNDGVLDSVDTCPNTPAGAQVDANGCEIIVDNDTDNDGVDNSIDQCPNTPAGAQVDANGCEIVAVVDADNDGVEDSLDMCPNTPAGAPVNGQGCADSQLDADNDGVSDDIDQCPSTPAGSVVDGTGCIVVTPPADSDNDGVVDTLDMCPNTAAGLTVDSQGCALSQLDSDNDGVTDDIDQCANTPSGETANATGCSSSQEGGGTDPDTPQPGLLYGELAGAMNVSDTNPNWERTTDLLQTEDSVKGNTTEVYTGFIYDADGHISFYEHIDDSVRLYIDGVLVLSNDSWEASSQTTDLNLTPGTHEIELRIGNADGGSGAVDGIGFGIDVDGGTNFVHPSTLSESIFT | |
PSQ00118 | FD00078 | Cysteine protease | A1KXI0 | Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Acari Acariformes Sarcoptiformes Astigmata Glycyphagoidea Echimyopodidae Blomia | Blomia tropicalis (Mite) | 90 | cysteine-type peptidase activity | 333 | None | None | 40697 | None | None | 27997997 | 90 | 19:108 | KPTREEIKTFEQFKKVFGKVYRNAEEEARREHHFKEQLKWVEEHNGIDGVEYAINEYSDMSEQEFSFHLSGGGLNFTYMKMEAAKEPLIN | |
PSQ00119 | FD00006 | Alpha-conotoxin Lp1 | A1X8B6 | Eukaryota Metazoa Spiralia Lophotrochozoa Mollusca Gastropoda Caenogastropoda Neogastropoda Conoidea Conidae Conus Lithoconus | Conus leopardus (Leopard cone) | 27 | acetylcholine receptor inhibitor activity, toxin activity | 68 | None | None | 101306 | extracellular region, host cell postsynaptic membrane | pathogenesis | 17400270 | 27 | 22:48 | FTSDRALDAMNAAASKKASRLIALAVR | |
PSQ00120 | FD00006 | Alpha-conotoxin-like Lp1 | A1X8C2 | Eukaryota Metazoa Spiralia Lophotrochozoa Mollusca Gastropoda Caenogastropoda Neogastropoda Conoidea Conidae Conus Lithoconus | Conus leopardus (Leopard cone) | 20 | acetylcholine receptor inhibitor activity, toxin activity | 64 | Alpha-conotoxin-like Lp1 | None | 101306 | extracellular region, host cell postsynaptic membrane | pathogenesis | 17400270 | 20 | 22:41 | FNSDRESNHENRRTSNQITR | |
PSQ00121 | FD00006 | Alpha-conotoxin-like Lp1 | A1X8C3 | Eukaryota Metazoa Spiralia Lophotrochozoa Mollusca Gastropoda Caenogastropoda Neogastropoda Conoidea Conidae Conus Lithoconus | Conus leopardus (Leopard cone) | 20 | acetylcholine receptor inhibitor activity, toxin activity | 64 | Alpha-conotoxin-like Lp1 | None | 101306 | extracellular region, host cell postsynaptic membrane | pathogenesis | 17400270 | 20 | 22:41 | FNSDRESNHENRRTSNQITR | |
PSQ00122 | FND00241 | Alpha-conotoxin-like Lp1 | A1X8D6 | Eukaryota Metazoa Spiralia Lophotrochozoa Mollusca Gastropoda Caenogastropoda Neogastropoda Conoidea Conidae Conus Lithoconus | Conus leopardus (Leopard cone) | 21 | acetylcholine receptor inhibitor activity, toxin activity | 37 | None | None | 101306 | extracellular region, host cell postsynaptic membrane | pathogenesis | 17400270 | 21 | 1:21 | SDDNDVAAEMMSGLIALAIDS | |
PSQ00123 | FD00006 | Alpha-conotoxin-like Pu1 | A1X8D8 | Eukaryota Metazoa Spiralia Lophotrochozoa Mollusca Gastropoda Caenogastropoda Neogastropoda Conoidea Conidae Conus | Conus pulicarius (Flea-bite cone) | 21 | acetylcholine receptor inhibitor activity, toxin activity | 41 | None | None | 93154 | extracellular region, host cell postsynaptic membrane | pathogenesis | 26948522 | 21 | 1:21 | LDGRNAAADFETSDLLAMTIR | |
PSQ00124 | FD00013 | Zinc metalloproteinase-disintegrin-like ohanin | A3R0T9 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Lepidosauria Squamata Bifurcata Unidentata Episquamata Toxicofera Serpentes Colubroidea Elapidae Elapinae Ophiophagus | Ophiophagus hannah (King cobra) (Naja hannah) | 167 | metalloendopeptidase activity, toxin activity, zinc ion binding | 611 | Snake venom metalloproteinase | None | 8665 | extracellular region, host extracellular space | envenomation resulting in fibrinogenolysis in other organism, envenomation resulting in hemorrhagic damage to other organism, envenomation resulting in negative regulation of platelet aggregation in other organism, envenomation resulting in proteolysis in other organism | 17337026 | 167 | 21:187 | IILESGKVNDYEVVYPQKIPVLPKSKIQRREQKMYEDTMKYEFKVNGEPVVLHLERNKELFSKDYTETHYSPDGREITTSPPVEDHCYYHGYIQSDIDSTAILNACNGLKGYFRHHGEAYHIEPLKFSDSEAHAVYKYENIEKEDETPKICGVKHSTWESDEPIEKI | |
PSQ00125 | FD00012 | Actinidain | A5HII1 | Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae asterids Ericales Actinidiaceae Actinidia | Actinidia deliciosa (Kiwi) | 102 | cysteine-type endopeptidase activity | 380 | Allergen Act d 1 | None | 3627 | None | None | 15536427, 18205857, 18442249 | 102 | 25:126 | FNAKNLTQRTNDEVKAMYESWLIKYGKSYNSLGEWERRFEIFKETLRFIDEHNADTNRSYKVGLNQFADLTDEEFRSTYLGFTSGSNKTKVSNRYEPRVGQV | |
PSQ00126 | FD00277 | Isoflavone 7-O-glucosyltransferase 1 | A6BM07 | Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids fabids Fabales Fabaceae Papilionoideae 50 kb inversion clade NPAAA clade indigoferoid/millettioid clade Phaseoleae Glycine Glycine subgen Soja | Glycine max (Soybean) (Glycine hispida) | 49 | isoflavone 7-O-glucosyltransferase activity | 480 | UDP-glucose | GmIF7GT1 | 3847 | None | None | 17565994 | 49 | 1:49 | MKDTIVLYPNLGRGHLVSMVELGKLILTHHPSLSITILILTPPTTPSTT | |
PSQ00127 | FD00467 | Putative fimbrium tip subunit Fim1C | A6LHQ6 | Bacteria Bacteroidetes Bacteroidia Bacteroidales Tannerellaceae Parabacteroides | Parabacteroides distasonis (strain ATCC 8503 , 5825 | 31 | None | 375 | None | None | 435591 | cell outer membrane, pilus | None | 26972441 | 31 | 17:47 | CVSCSKDEDPVLPLEGAKLSVAVKASGTATK | |
PSQ00128 | FND00093 | Putative fimbrium tip subunit Fim1F | A6LHQ9 | Bacteria Bacteroidetes Bacteroidia Bacteroidales Tannerellaceae Parabacteroides | Parabacteroides distasonis (strain ATCC 8503 , 5825 | 26 | None | 318 | None | None | 435591 | pilus | None | 26972441 | 26 | 25:50 | VPIGFDTDELSFDMSLVLLTGDMQTK | |
PSQ00129 | FD00006 | Alpha-conotoxin-like Lp1 | A6M938 | Eukaryota Metazoa Spiralia Lophotrochozoa Mollusca Gastropoda Caenogastropoda Neogastropoda Conoidea Conidae Conus Lithoconus | Conus leopardus (Leopard cone) | 27 | acetylcholine receptor inhibitor activity, toxin activity | 45 | None | None | 101306 | extracellular region, host cell postsynaptic membrane | pathogenesis | 17400270 | 27 | 1:27 | VVLGPASDGRNAAANVKAPDLIALTVR | |
PSQ00130 | FND00017 | Riparin-1 | A6MWS7 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Myobatrachoidea Myobatrachidae Myobatrachinae Crinia | Crinia riparia (Streambank froglet) (Flinders Ranges froglet) | 26 | None | 60 | None | None | 446489 | extracellular region | defense response | 16470724 | 26 | 16:41 | QVCLVSAAEMGHSSDNELSSRDLVKR | |
PSQ00131 | FND00017 | Riparin-1 | A6MWS8 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Myobatrachoidea Myobatrachidae Myobatrachinae Crinia | Crinia riparia (Streambank froglet) (Flinders Ranges froglet) | 26 | None | 68 | None | None | 446489 | extracellular region | defense response | 18601958 | 26 | 16:41 | QVCLVSAAEMEHSSDNELSSRDLVKR | |
PSQ00132 | FND00017 | Riparin-1 | A6MWS9 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Myobatrachoidea Myobatrachidae Myobatrachinae Crinia | Crinia riparia (Streambank froglet) (Flinders Ranges froglet) | 26 | None | 60 | None | None | 446489 | extracellular region | defense response | 16470724 | 26 | 16:41 | QVCLVSAAEMEHSSDNELSSRDLVKR | |
PSQ00133 | FND00017 | Riparin-1 | A6MWT0 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Myobatrachoidea Myobatrachidae Myobatrachinae Crinia | Crinia riparia (Streambank froglet) (Flinders Ranges froglet) | 26 | None | 68 | None | None | 446489 | extracellular region | defense response | 18601958 | 26 | 16:41 | QVCLVSAAEMGHSSDNELSSRDLVKR | |
PSQ00134 | FND00190 | FMRFamide neuropeptides | A6P3B2 | Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Diptera Brachycera Muscomorpha Muscoidea Muscidae Musca | Musca domestica (House fly) | 151, 14 | None | 388 | None | fmrf | 7370 | extracellular region | neuropeptide signaling pathway | 18789334;18789334 | 165 | 22:172, 375:388 | YVGGNSLNSNSLHASYSEFPAGTSNEVPEDAANGQDDNDDSQLTEPNDNNAPLVQSIDDETEMQFPKPIQWVSIDHLRNSIILRFQNPTPKILNKLDPEEMKRLRSLQENAMRWGKRSYESYPLNRNGLADKSSVGRMGFLSNHQVIRDSR, SLDKSENKTSDLQK | |
PSQ00135 | FD00188 | Iron-regulated surface determinant protein B | A6QG30 | Bacteria Firmicutes Bacilli Bacillales Staphylococcaceae Staphylococcus | Staphylococcus aureus (strain Newman) | 32 | heme transmembrane transporter activity, metal ion binding | 645 | Fur-regulated protein B, Staphylococcal iron-regulated protein H, Staphylococcus aureus surface protein J | isdB | 426430 | cell wall, extracellular region | pathogenesis | 11830639 | 32 | 614:645 | GEESNKDMTLPLMALLALSSIVAFVLPRKRKN | |
PSQ00136 | FND00067 | Mu-conotoxin cal12a | A6YR20 | Eukaryota Metazoa Spiralia Lophotrochozoa Mollusca Gastropoda Caenogastropoda Neogastropoda Conoidea Conidae Californiconus | Californiconus californicus (California cone) (Conus californicus) | 23 | ion channel inhibitor activity, toxin activity | 87 | Conotoxin Cal 12, Conotoxin CalTx 12 | None | 1736779 | extracellular region | pathogenesis | 21147978 | 23 | 20:42 | ITNNYIRGAARKVTPWRRNLKTR | |
PSQ00137 | FND00067 | Mu-conotoxin cal12b | A6YR21 | Eukaryota Metazoa Spiralia Lophotrochozoa Mollusca Gastropoda Caenogastropoda Neogastropoda Conoidea Conidae Californiconus | Californiconus californicus (California cone) (Conus californicus) | 23 | ion channel inhibitor activity, toxin activity | 87 | Conotoxin Cal 12, Conotoxin CalTx 12 | None | 1736779 | extracellular region | pathogenesis | 21147978 | 23 | 20:42 | ITNNYIRGAARKVTPWRRNLKTR | |
PSQ00138 | FD00337 | Tyrosinase | A7BHQ9 | Eukaryota Fungi Dikarya Basidiomycota Agaricomycotina Agaricomycetes Agaricomycetidae Agaricales Strophariaceae Pholiota | Pholiota nameko | 238 | copper ion binding, monophenol monooxygenase activity | 625 | None | tyr1 | 61267 | None | melanin biosynthetic process | 17617709 | 238 | 388:625 | SGFAAATSAIGAGSVASLAADVPLEKAPAPAPEAAAQPPVPAPAHVEPAVRAVSVHAAAAQPHAEPPVHVSAGGHPSPHGFYDWTARIEFKKYEFGSSFSVLLFLGPVPEDPEQWLVSPNFVGAHHAFVNSAAGHCANCRSQGNVVVEGFVHLTKYISEHAGLRSLNPEVVEPYLTNELHWRVLKADGSVGQLESLEVSVYGTPMNLPVGAMFPVPGNRRHFHGITHGRVGGSRHAIV | |
PSQ00139 | FND00096 | Ixosin-B | A7UDM9 | Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Acari Parasitiformes Ixodida Ixodoidea Ixodidae Ixodinae Ixodes | Ixodes sinensis (Hard tick) | 31 | None | 89 | None | None | 339422 | None | defense response to fungus, defense response to Gram-negative bacterium, defense response to Gram-positive bacterium, killing of cells of other organism | 18295522 | 31 | 27:57 | SMEYLVTAPGYLTPNADIKITAVVTNPSSAG | |
PSQ00140 | FD00002 | Esculentin-2PLa | A7WNV5 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Ranoidea Ranidae Lithobates | Lithobates palustris (Pickerel frog) (Rana palustris) | 17 | None | 78 | None | None | 298395 | extracellular region | defense response to bacterium, defense response to fungus, killing of cells of other organism | 11087945 | 17 | 23:39 | EEERGADEEEGDGEKLM | |
PSQ00141 | FND00295 | PBAN-type neuropeptides | A8CL69 | Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Hymenoptera Apocrita Aculeata Apoidea Apidae Apis | Apis mellifera (Honeybee) | 30, 32, 23, 18 | myostimulatory hormone activity, neuropeptide hormone activity | 195 | Pheromone | PBAN | 7460 | extracellular space | neuropeptide signaling pathway | 17068263;17068263;17068263;17068263 | 103 | 34:63, 86:117, 131:153, 178:195 | EYDGRDSSSGSNNDRAPSNEFGSCTDGKCI, ADRKPEINSDIEAFANAFEEPHWAIVTIPETE, ESGEDYFSYGFPKDQEELYTEEQ, QLHNIVDKPRQNFNDPRF | |
PSQ00142 | FND00185 | Pleurain-A1 | A8DY01 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Ranoidea Ranidae Nidirana | Nidirana pleuraden (Yunnan pond frog) (Babina pleuraden) | 25 | None | 69 | None | None | 369511 | extracellular region | defense response to bacterium, hemolysis in other organism | 17764786 | 25 | 19:43 | ISLCKQERDADEDDGRKMTEEEVKR | |
PSQ00143 | FD00354 | Secreted aspartyl protease 1 | A8PZM4 | Eukaryota Fungi Dikarya Basidiomycota Ustilaginomycotina Malasseziomycetes Malasseziales Malasseziaceae Malassezia | Malassezia globosa (strain ATCC MYA-4612 , fungus) | 68 | aspartic-type endopeptidase activity | 395 | None | SAP1 | 425265 | extracellular region | None | 29246799 | 68 | 21:88 | SELPSPMTVNLERRKMLVTKNDTVDFKAVRKQANALNYKYDKLLRNFRKNTGRDHPLLHLLLDLIDKR | |
PSQ00144 | FD00007 | Alpha- and beta-fibrinogenase OhS1 | A8QL56 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Lepidosauria Squamata Bifurcata Unidentata Episquamata Toxicofera Serpentes Colubroidea Elapidae Elapinae Ophiophagus | Ophiophagus hannah (King cobra) (Naja hannah) | 6 | serine-type endopeptidase activity, toxin activity | 260 | Snake venom serine protease | None | 8665 | extracellular region | None | 17408712 | 6 | 19:24 | VTPFDR | |
PSQ00145 | FD00562 | Millepora cytotoxin-1 | A8QZJ5 | Eukaryota Metazoa Cnidaria Hydrozoa Hydroidolina Anthoathecata Capitata Milleporidae Millepora | Millepora dichotoma (Net fire coral) | 55 | None | 222 | None | None | 544484 | extracellular region, nematocyst | None | 17983598 | 55 | 21:75 | APKPDTHNPFDELSSVAEKQDLHYGDRSRKDPFIAQNDVGNNFRDGTQENLTKVR | |
PSQ00146 | FD00008 | Phallacidin proprotein 1 | A8W7M6 | Eukaryota Fungi Dikarya Basidiomycota Agaricomycotina Agaricomycetes Agaricomycetidae Agaricales Amanitaceae Amanita | Amanita bisporigera (Destroying angel) | 10, 14 | toxin activity | 31 | None | PHA1_2 | 87325 | None | None | 18025465;18025465 | 24 | 1:10, 18:31 | MSDINATRLP, CVGDDVNRLLTRGE | |
PSQ00147 | FD00008 | Phallacidin proprotein 1 | A8W7M7 | Eukaryota Fungi Dikarya Basidiomycota Agaricomycotina Agaricomycetes Agaricomycetidae Agaricales Amanitaceae Amanita | Amanita bisporigera (Destroying angel) | 10, 17 | toxin activity | 34 | None | PHA1_1 | 87325 | None | None | 18025465;18025465 | 27 | 1:10, 18:34 | MSDINATRLP, CVGDDVNRLLTRGESLC | |
PSQ00148 | FD00009 | MSDIN-like toxin proprotein 1 | A8W7M9 | Eukaryota Fungi Dikarya Basidiomycota Agaricomycotina Agaricomycetes Agaricomycetidae Agaricales Amanitaceae Amanita | Amanita bisporigera (Destroying angel) | 10, 14 | toxin activity | 32 | None | MSD1 | 87325 | None | None | 18025465;18025465 | 24 | 1:10, 19:32 | MSDINVTRLP, CVGDDVNTALTRGE | |
PSQ00149 | FD00008 | MSDIN-like toxin proprotein 2 | A8W7N0 | Eukaryota Fungi Dikarya Basidiomycota Agaricomycotina Agaricomycetes Agaricomycetidae Agaricales Amanitaceae Amanita | Amanita bisporigera (Destroying angel) | 10, 14 | toxin activity | 34 | None | MSD2 | 87325 | None | None | 18025465;18025465 | 24 | 1:10, 21:34 | MSDINTARLP, CVGDDIEMVLARGE | |
PSQ00150 | FD00008 | MSDIN-like toxin proprotein 3 | A8W7N1 | Eukaryota Fungi Dikarya Basidiomycota Agaricomycotina Agaricomycetes Agaricomycetidae Agaricales Amanitaceae Amanita | Amanita bisporigera (Destroying angel) | 10, 14 | toxin activity | 34 | None | MSD3 | 87325 | None | None | 18025465;18025465 | 24 | 1:10, 21:34 | MSDINTARLP, CVGDDIEMVLTRGE |