Home Advance Search BLAST Contact Documentation/Help Feedback
Family
Protein Name
Uniprot ID
Taxonomy
Organism
Prosequence length
Functions
Preproprotein length
Alt Name
Gene Name
NCBI ID
Cell Org
Process
PubMed
Total Proseq length
Proseq Loc
Prosequence Sequence

Download whole result Csv
Proseq ID Family Protein Name Uniprot ID Taxonomy Organism Prosequence length Functions Preproprotein length Alter Name Gene Name NCBI ID Cell Org Process PubMed Total Proseq length Proseq Loc Prosequence Sequence
PSQ00251 FND00029 Preprofallaxidin-3 B5LUQ7 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Hyloidea Hylidae Pelodryadinae Litoria Litoria fallax (Eastern dwarf tree frog) (Hylomantis fallax) 24 None 123 None None 115422 extracellular region defense response to bacterium 18803332 24 23:46 EEKKRENEDDAEDENHEEESEEKR
PSQ00252 FD00002 Preprofallaxidin-6 B5LUQ8 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Hyloidea Hylidae Pelodryadinae Litoria Litoria fallax (Eastern dwarf tree frog) (Hylomantis fallax) 27 None 103 None None 115422 extracellular region defense response to bacterium 18803332 27 23:49 EEEKRENEGNENEEEDENHEEGSEEKR
PSQ00253 FD00002 Preprofallaxidin-7 B5LUQ9 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Hyloidea Hylidae Pelodryadinae Litoria Litoria fallax (Eastern dwarf tree frog) (Hylomantis fallax) 24, 6 None 132 None None 115422 extracellular region defense response 18803332;18803332 30 23:46, 91:96 EEKKRENEDDAEDGNHEEESEEKR, RSEEKR
PSQ00254 FND00029 Preprofallaxidin-8 B5LUR0 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Hyloidea Hylidae Pelodryadinae Litoria Litoria fallax (Eastern dwarf tree frog) (Hylomantis fallax) 24 None 109 None None 115422 extracellular region defense response to Gram-positive bacterium 18803332 24 23:46 EEQKRENEEDAEDENHEEESEEKR
PSQ00255 FND00029 Preprofallaxidin-9 B5LUR1 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Hyloidea Hylidae Pelodryadinae Litoria Litoria fallax (Eastern dwarf tree frog) (Hylomantis fallax) 24 None 94 None None 115422 extracellular region defense response to Gram-positive bacterium 18803332 24 23:46 EEEKRENEEDAEDENHEEESEEKR
PSQ00256 FD00036 Lantibiotic nukacin B5MFD0 Bacteria Firmicutes Bacilli Bacillales Staphylococcaceae Staphylococcus Staphylococcus hominis 30 signaling receptor binding 60 Nukacin KQ-1, Nukacin KQU-131 nukA 1290 extracellular region cytolysis, defense response to bacterium 18685189 30 1:30 MENSKIMKDIEVANLLEEVQEDELNEVLGA
PSQ00257 FD00020 Cathelicidin-related antimicrobial peptide Bf-CRAMP B6D434 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Lepidosauria Squamata Bifurcata Unidentata Episquamata Toxicofera Serpentes Colubroidea Elapidae Bungarinae Bungarus Bungarus fasciatus (Banded krait) (Pseudoboa fasciata) 139 None 191 Cathelicidin-BF , Vipericidin None 8613 extracellular region, membrane, other organism cell membrane defense response to bacterium, defense response to fungus, innate immune response, killing of cells of other organism 18795096 139 23:161 LPHKPLIYEEAVDLAVSIYNSKSGEDSLYRLLEAVSPPKWDPLSESNQELNFTMKETVCLVAEERSLEECDFQEDGVVMGCTGYYFFGESPPVVVLTCKPVGEEGEQKQEEGNEEEKEVEEEEQEEDEKDQPRRVKRFK
PSQ00258 FND00086 Orcokinin peptides B6DT16 Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Paraneoptera Hemiptera Heteroptera Panheteroptera Cimicomorpha Reduviidae Triatominae Rhodnius Rhodnius prolixus (Triatomid bug) 12, 11 None 69 Orcoquinin None 13249 extracellular region neuropeptide signaling pathway 19137558;19137558 23 1:12, 59:69 MSFFYSSAYAAD, GSFIKKSEPHH
PSQ00259 FND00004 Caerin-regulated peptide B6HY14 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Hyloidea Hylidae Phyllomedusinae Agalychnis Agalychnis callidryas (Red-eyed tree frog) (Phyllomedusa callidryas) 21 None 72 CRP-AC1 None 197464 extracellular region defense response to bacterium 18555027 21 23:43 DEEKRENEDEEEQEDDEQSEE
PSQ00260 FND00004 Adenoregulin-related peptide B6HY15 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Hyloidea Hylidae Phyllomedusinae Agalychnis Agalychnis callidryas (Red-eyed tree frog) (Phyllomedusa callidryas) 21 None 81 ARP-AC1 None 197464 extracellular region defense response to bacterium 18555027 21 23:43 EEEKRENEDEEEQEDDEQSEM
PSQ00261 FND00004 Dermaseptin-related peptide B6HY16 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Hyloidea Hylidae Phyllomedusinae Agalychnis Agalychnis callidryas (Red-eyed tree frog) (Phyllomedusa callidryas) 21 None 75 DRP-AC4 None 197464 extracellular region defense response to bacterium 18555027 21 23:43 EEERRENEDEEEQEDDEQSEM
PSQ00262 FD00020 Cathelicidin-related antimicrobial peptide Na_CRAMP B6S2X0 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Lepidosauria Squamata Bifurcata Unidentata Episquamata Toxicofera Serpentes Colubroidea Elapidae Elapinae Naja Naja atra (Chinese cobra) 139 None 191 Cathelicidin-NA antimicrobial peptide, Vipericidin None 8656 extracellular region, membrane, other organism cell membrane defense response to bacterium, defense response to fungus, innate immune response, killing of cells of other organism 18620012 139 23:161 FPHKPLTYEEAVDLAVSVYNSKSGEDSLYRLLEAVPALKWDALSESNQELNFSVKETVCQMAEERSLEECDFQEAGAVMGCTGYYFFGESPPVLVLTCKSVGNEEEQKQEEGNEEEKEVEKEEKEEDQKDQPKRVKRFK
PSQ00263 FD00020 Cathelicidin-related peptide Oh-Cath B6S2X2 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Lepidosauria Squamata Bifurcata Unidentata Episquamata Toxicofera Serpentes Colubroidea Elapidae Elapinae Ophiophagus Ophiophagus hannah (King cobra) (Naja hannah) 139 None 191 Cathelicidin-related antimicrobial peptide , Vipericidin None 8665 extracellular region, membrane, other organism cell membrane defense response to bacterium, defense response to fungus, innate immune response, killing of cells of other organism 18620012 139 23:161 LPHKPLTYEEAVDLAVSIYNSKSGEDSLYRLLEAVPPPEWDPLSESNQELNFTIKETVCLVAEERSLEECDFQEDGAIMGCTGYYFFGESPPVLVLTCKPVGEEEEQKQEEGNEEEKEVEKEEKEEDEKDQPRRVKRFK
PSQ00264 FD00022 Theta defensin subunit A B6ULW4 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Cercopithecidae Cercopithecinae Papio Papio anubis (Olive baboon) 42 None 76 BTD-1 subunit 1, BTD-3, BTD-4 subunit 1, BTD-7 subunit 1 BTDA 9555 extracellular space defense response to bacterium, defense response to fungus, killing of cells of other organism 18852242 42 23:64 RQARADEAAAQQQPGADDQGMAHSFTWPENAALPLSESAKGL
PSQ00265 FD00022 Theta defensin subunit B B6ULW5 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Cercopithecidae Cercopithecinae Papio Papio anubis (Olive baboon) 42 None 76 BTD-1 subunit 2, BTD-2 BTDB 9555 extracellular space defense response to bacterium, defense response to fungus, killing of cells of other organism 18852242 42 23:64 RQARADEAAAQQQPGADDQGMAHSFTRPENAALPLSESAKGL
PSQ00266 FD00022 Theta defensin subunit C B6ULW6 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Cercopithecidae Cercopithecinae Papio Papio anubis (Olive baboon) 42 None 76 BTD-4 subunit 2 BTDC 9555 extracellular space defense response to bacterium, defense response to fungus, killing of cells of other organism 18852242 42 23:64 RQARADEAAIQEQPGADDQGMAHSFTRNESAVLPLSESERGL
PSQ00267 FD00022 Theta defensin subunit D B6ULW7 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Cercopithecidae Cercopithecinae Papio Papio anubis (Olive baboon) 42 None 76 BTD-7 subunit 2 BTDD 9555 extracellular space defense response to bacterium, defense response to fungus, killing of cells of other organism 18852242 42 23:64 RQARADEAAAQQQPGADDQGMAHSFTRPENAALPLSESAKGL
PSQ00268 FD00141 Neurotrophin 1 B7TB45 Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Diptera Brachycera Muscomorpha Ephydroidea Drosophilidae Drosophila Sophophora Drosophila melanogaster (Fruit fly) 469 growth factor activity, receptor ligand activity, Toll binding 886 Neurotrophic factor 1 , Protein spaetzle 2 , Protein spatzle 2 NT1 7227 extracellular region, extracellular space axon guidance, central nervous system formation, innate immune response, motor neuron axon guidance, nervous system development, regulation of cell death, regulation of neuronal synaptic plasticity in response to neurotrophin, regulation of Toll signaling pathway, Toll signaling pathway 24124519 469 30:498 DDELMDFDFADSNDAAMEDWQLDDLEEAKKAEQAEKKLESNMLDFSVDLDEPEPEKQLPPFDWRERVLRNALAKALADEGLRQKFAEVLPILRMLSSQQRLALSALISAQMNAKKGHELKFEQVRMMFGNEKKLLLPIVFDIANLIKSSTRKYINLGSDLASSALYHTPINRREDDLTPEESQQDDQLGTIAVEVEPKKVSTEEVQLESLEDFFDEMGSEVLDPQMINEALTGDLHDNKTKTFKPENHGQRVRRSANEFVHKLTRSVPASVTEQQLLGGIAGRTIKLNTTAFQQPSSQEEEKMASSNGGQSYSEVEDLAFAGLNGTEIPLSADERLDLQRNSAEETEEPLPSPEELIAGPRYRLGKRPLPGQKSGSPIKRKRVTSSLRGRPKTAASSHKPVVTPPNKKCERFTSNMCIRTDDYPLEQIMGSIRRHKNAMSALLAEFYDKPNNNLEFSDDFDDFSLSKKR
PSQ00269 FD00013 Zinc metalloproteinase-disintegrin-like daborhagin-K B8K1W0 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Lepidosauria Squamata Bifurcata Unidentata Episquamata Toxicofera Serpentes Colubroidea Viperidae Viperinae Daboia Daboia russelii (Russel 169 metal ion binding, metalloendopeptidase activity, toxin activity 615 Haemorrhagic metalloproteinase russelysin, Snake venom metalloproteinase None 8707 extracellular region None 18554518 169 21:189 IILESGNVNDYEVVYPQKVTAMPKEAVKQPEQKYEDAMQYKFEVNGEPVLLHLEKNKDLFSEDYSETHYSPDGREITTKPLVQDHCYYHGHIQNDAHSSASISACNGLKGHFKLRGEMYLIEPLKLSDSEAHAVYKYENVEKEDEALKMCGVTQTNWESDEPIKKASLL
PSQ00270 FND00310 Hadrucalcin B8QG00 Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Scorpiones Iurida Iuroidea Hadrurus Hoffmannihadrurus gertschi (Scorpion) (Hadrurus gertschi) 12 calcium channel inhibitor activity, toxin activity 74 None None 380989 extracellular region pathogenesis 19389159 12 28:39 REIEFNAGRVVR
PSQ00271 FD00134 Unique cartilage matrix-associated protein B9TQX1 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Actinopterygii Chondrostei Acipenseriformes Acipenseridae Acipenser Acipenser naccarii (Adriatic sturgeon) 39 None 139 None ucma 42330 extracellular region regulation of osteoblast differentiation 18836183 39 27:65 AAVRTDKSDIKREDGENMKKRIFMQESEATAFLKRRGRR
PSQ00272 FD00518 Aromatic peroxygenase B9W4V6 Eukaryota Fungi Dikarya Basidiomycota Agaricomycotina Agaricomycetes Agaricomycetidae Agaricales Bolbitiaceae Agrocybe Agrocybe aegerita (Black poplar mushroom) (Agaricus aegerita) 25 heme binding, metal ion binding, peroxidase activity 371 None APO1 5400 None hydrogen peroxide catabolic process 15294788, 17601809 25 19:43 FPAYASLAGLSQQELDAIIPTLEAR
PSQ00273 FND00107 Small cysteine-rich protein 1 1 C0H693 Eukaryota Metazoa Cnidaria Anthozoa Hexacorallia Scleractinia Astrocoeniina Acroporidae Montipora Montipora capitata (Rice coral) 20 toxin activity 81 None None 46704 extracellular region, nematocyst None 19283069 20 20:39 QTLKATEKDDSTDENPFGIY
PSQ00274 FD00002 Tryptophyllin-1 C0HJF6 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Hyloidea Hylidae Phyllomedusinae Phyllomedusa Phyllomedusa sauvagei (Sauvage 31 None 61 None None 8395 extracellular region defense response 23518460 31 23:53 DEEKRQDDDESNESEEKKEIHEEGSQEERRE
PSQ00275 FND00342 Cytoinsectotoxin-4 C0HJV6 Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Araneomorphae Entelegynae Entelegynae incertae sedis Zodariidae Lachesana Lachesana tarabaevi (Spider) 43 toxin activity 124 None None 379576 extracellular region defense response to bacterium 27287558 43 20:62 SEPAETENEDLDDLSDLEDEEWLDELEEAAEYLESLREFEESR
PSQ00276 FND00050 Met-lysine-1a C0HJV7 Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Araneomorphae Entelegynae Entelegynae incertae sedis Zodariidae Lachesana Lachesana tarabaevi (Spider) 47 None 121 None None 379576 extracellular region None 27287558 47 23:69 DHTGYEEEENLEDSELTDLVTAALLEELAEASEMDDLSYTEEAGGER
PSQ00277 FND00050 Met-lysine-1b C0HJV8 Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Araneomorphae Entelegynae Entelegynae incertae sedis Zodariidae Lachesana Lachesana tarabaevi (Spider) 47 None 121 None None 379576 extracellular region None 27287558 47 23:69 DHTGYEEEENLEDSELTDLVAAALLEELAEASEMDDLSYTEEAGGER
PSQ00278 FND00089 Tau-AnmTx Ueq 12-1 C0HK26 Eukaryota Metazoa Cnidaria Anthozoa Hexacorallia Actiniaria Actiniidae Urticina Urticina eques (Sea anemone) 9 toxin activity 74 None None 417072 extracellular region defense response to bacterium 28468269 9 19:27 AGFGKRTLK
PSQ00279 FD00045 Lectin C0HK27 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids fabids Fabales Fabaceae Papilionoideae 50 kb inversion clade NPAAA clade indigoferoid/millettioid clade Phaseoleae Dioclea Dioclea lasiophylla 16, 11 mannose binding, metal ion binding, toxin activity 298 None None 1457464 None None 28196677;28196677 27 147:162, 281:291 NIIKNSTNLDFNAAYN, QLQDLRIASVV
PSQ00280 FD00122 ATP synthase subunit a C0HK57 Eukaryota Fungi Dikarya Ascomycota Saccharomycotina Saccharomycetes Saccharomycetales Pichiaceae Ogataea Pichia angusta (Yeast) (Hansenula polymorpha) 7 proton transmembrane transporter activity 259 F-ATPase protein 6 ATP6 870730 integral component of membrane, mitochondrial inner membrane, proton-transporting ATP synthase complex, coupling factor F(o) ATP synthesis coupled proton transport 25759169 7 1:7 MTNNYIN
PSQ00281 FD00025 Cliotide T9 C0HKG0 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids fabids Fabales Fabaceae Papilionoideae 50 kb inversion clade NPAAA clade indigoferoid/millettioid clade Phaseoleae Clitoria Clitoria ternatea (Butterfly pea) 62 None 120 None None 43366 None defense response 21596752 62 56:117 HVIAAEANSIDDHHLLCQSHDDCIKKGTGNFCAPFLDHACQYGWCFRAESEGYLLKDFLKMP
PSQ00282 FD00119 Cliotide T3 C0HKG1 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids fabids Fabales Fabaceae Papilionoideae 50 kb inversion clade NPAAA clade indigoferoid/millettioid clade Phaseoleae Clitoria Clitoria ternatea (Butterfly pea) 74 None 127 None None 43366 None defense response 21596752 74 54:127 HIIAANAKTVNEHRLLCTSHEDCFKKGTGNYCASFPDSNIHFGWCFHAESEGYLLKDFMNMSKDDLKMPLESTN
PSQ00283 FD00064 DELTA-miturgitoxin-Cp1a C0HKG7 Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Araneomorphae Entelegynae Entelegynae incertae sedis Cheiracanthiidae Cheiracanthium Cheiracanthium punctorium (Yellow sac spider) (Aranea punctoria) 27 toxin activity 183 Double-knot toxin , Toxin CpTx1 , Toxin CpTx1a None 682790 extracellular region, integral component of membrane, other organism cell membrane cytolysis 20657014 27 21:47 ESEIDLEDEEHFMSSDSFLSEIQDESR
PSQ00284 FD00064 DELTA-miturgitoxin-Cp1b C0HKG8 Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Araneomorphae Entelegynae Entelegynae incertae sedis Cheiracanthiidae Cheiracanthium Cheiracanthium punctorium (Yellow sac spider) (Aranea punctoria) 27 toxin activity 183 Toxin CpTx1 , Toxin CpTx1b None 682790 extracellular region, integral component of membrane, other organism cell membrane cytolysis 20657014 27 21:47 ESEIDLEDEEHFMSSDSFLSEIQDESR
PSQ00285 FD00064 DELTA-miturgitoxin-Cp1c C0HKG9 Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Araneomorphae Entelegynae Entelegynae incertae sedis Cheiracanthiidae Cheiracanthium Cheiracanthium punctorium (Yellow sac spider) (Aranea punctoria) 27 toxin activity 183 Toxin CpTx1 , Toxin CpTx1c None 682790 extracellular region, integral component of membrane, other organism cell membrane cytolysis 20657014 27 21:47 ESEIDLEDEEHFMSSDSFLSEIQDESR
PSQ00286 FD00216 Adipokinetic prohormone type 2 C0HKR1 Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Lepidoptera Glossata Ditrysia Noctuoidea Noctuidae Noctuinae Noctuini Agrotis Agrotis ipsilon (Black cutworm moth) 40 hormone activity 73 None None 56364 extracellular region neuropeptide signaling pathway 29466015 40 34:73 SISSEQINDDCNPEEAIFQIYKLIVSEGERIRACQRDGKM
PSQ00287 FD00079 Insulin-related peptide 1 C0HKS3 Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Lepidoptera Glossata Ditrysia Noctuoidea Noctuidae Noctuinae Noctuini Agrotis Agrotis ipsilon (Black cutworm moth) 25, 20 hormone activity 87 None None 56364 extracellular region neuropeptide signaling pathway 29466015;29466015 45 20:44, 68:87 QESTNFYCGRTLSRALAVLCYGAES, GPVDECCEKACSIQELMTYC
PSQ00288 FD00079 Insulin-related peptide 2 C0HKS4 Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Lepidoptera Glossata Ditrysia Noctuoidea Noctuidae Noctuinae Noctuini Agrotis Agrotis ipsilon (Black cutworm moth) 24, 20 growth factor activity, hormone activity 86 None None 56364 extracellular space neuropeptide signaling pathway 29466015;29466015 44 20:43, 67:86 QEGTNFYCGRQLSRTLALVCWGAE, GPVDECCLKPCSIEEMLTYC
PSQ00289 FD00079 Insulin-related peptide 4 C0HKS5 Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Lepidoptera Glossata Ditrysia Noctuoidea Noctuidae Noctuinae Noctuini Agrotis Agrotis ipsilon (Black cutworm moth) 26, 20 hormone activity 88 None None 56364 extracellular region neuropeptide signaling pathway 29466015;29466015 46 20:45, 69:88 QNEARVFCGRVLSERLAALCWGPNSV, GLATECCDKACTVEELLSYC
PSQ00290 FD00098 PBAN-type neuropeptides C0HL17 Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Lepidoptera Glossata Ditrysia Noctuoidea Noctuidae Heliothinae Heliothis Heliothis peltigera (Bordered straw moth) (Noctua peltigera) 44, 23 neuropeptide hormone activity 194 None None 542982 extracellular region neuropeptide signaling pathway, pheromone biosynthetic process 28502715;28502715 67 51:94, 172:194 SLRIATEDNRQAFFKLLEAADALKYYYDQLPYEMQADEPETRVT, ELSYDMLPNKIRVARSTNKTRST
PSQ00291 FD00216 Adipokinetic prohormone type 1 C0HL92 Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Lepidoptera Glossata Ditrysia Noctuoidea Noctuidae Noctuinae Noctuini Agrotis Agrotis ipsilon (Black cutworm moth) 35 hormone activity 68 None None 56364 extracellular region neuropeptide signaling pathway 29466015 35 34:68 SGVAPMSCKNEEAVATIFKLIQNEAERFIICQQKS
PSQ00292 FND00139 Wasabi receptor toxin C0HLG4 Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Scorpiones Iurida Scorpionoidea Scorpionidae Urodacinae Urodacus Urodacus manicatus (Black rock scorpion) 14 toxin activity 68 None None 1330407 extracellular region, host cell cytoplasm None 31447178 14 22:35 MNFAWAESSEKVER
PSQ00293 FD00062 Lantibiotic flavucin C0XTM5 Bacteria Actinobacteria Corynebacteriales Corynebacteriaceae Corynebacterium Corynebacterium lipophiloflavum (strain ATCC 700352 , 37336 20 signaling receptor binding 58 None flaA 525263 extracellular region cytolysis, defense response to bacterium 27294279 20 1:20 MSDFTLDFAEGDAADTVSPQ
PSQ00294 FD00029 Phospholipase A2 Scol C1JAR9 Eukaryota Metazoa Ecdysozoa Arthropoda Myriapoda Chilopoda Pleurostigmophora Scolopendromorpha Scolopendridae Scolopendra Scolopendra viridis (Giant centipede) 6 calcium ion binding, phospholipase A2 activity, phospholipase A2 activity (consuming 1,2-dipalmitoylphosphatidylcholine), phospholipase A2 activity consuming 1,2-dioleoylphosphatidylethanolamine) 147 None None 118503 extracellular region arachidonic acid secretion, lipid catabolic process, phospholipid metabolic process 19285520 6 23:28 SPIERR
PSQ00295 FD00002 Gaegurin-LK1 C3RT17 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Ranoidea Dicroglossidae Dicroglossinae Limnonectes Limnonectes kuhlii (Kuhl 22 None 70 None None 110107 extracellular region defense response to fungus, defense response to Gram-negative bacterium, defense response to Gram-positive bacterium, killing of cells of other organism 23054029 22 23:44 EEERNAEEEKRDGDDEMDVEVQ
PSQ00296 FD00002 Gaegurin-LK2 C3RT18 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Ranoidea Dicroglossidae Dicroglossinae Limnonectes Limnonectes kuhlii (Kuhl 22 None 70 None None 110107 extracellular region defense response to fungus, defense response to Gram-negative bacterium, defense response to Gram-positive bacterium, killing of cells of other organism 23054029 22 23:44 EEERNAEEEKRDGDDEMDVEVQ
PSQ00297 FND00001 Temporin-LK1 C3RT22 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Ranoidea Dicroglossidae Dicroglossinae Limnonectes Limnonectes kuhlii (Kuhl 22 None 65 None None 110107 extracellular region defense response to fungus, defense response to Gram-negative bacterium, defense response to Gram-positive bacterium, disruption of cells of other organism, killing of cells of other organism 23054029 22 23:44 QEERNAEEERRDGDDEGSVEVQ
PSQ00298 FD00002 Rugosin-LK1 C3RT23 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Ranoidea Dicroglossidae Dicroglossinae Limnonectes Limnonectes kuhlii (Kuhl 18 None 75 None None 110107 extracellular region defense response to fungus, defense response to Gram-negative bacterium, defense response to Gram-positive bacterium, killing of cells of other organism 23054029 18 23:40 EEERSADEDDEGEMTEEE
PSQ00299 FD00002 Rugosin-LK2 C3RT24 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Ranoidea Dicroglossidae Dicroglossinae Limnonectes Limnonectes kuhlii (Kuhl 16 None 75 None None 110107 extracellular region defense response to fungus, defense response to Gram-negative bacterium, defense response to Gram-positive bacterium, killing of cells of other organism 23054029 16 25:40 ERSADEDDEGEMTEEE
PSQ00300 FND00009 Alpha-conotoxin Ms20 C3VVN5 Eukaryota Metazoa Spiralia Lophotrochozoa Mollusca Gastropoda Caenogastropoda Neogastropoda Conoidea Conidae Conus Rhizoconus Conus mustelinus (Weasel cone) 21 toxin activity 94 Conopeptide alpha-D Ms None 101309 extracellular region, host cell postsynaptic membrane None 19275168, 19393680 21 25:45 QVVQGDRRGNGLARYLQRGDR
Total Pages 43
Go to Lab Web Page