Details of PSQ00243
| ProSeqID |
PSQ00243 |
| Family |
FD00002 |
| Protein Name |
Temporin-SHc |
| UniProt ID |
B3KYH6
|
| Taxonomy |
Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Amphibia-Batrachia-Anura-Neobatrachia-Ranoidea-Ranidae-Pelophylax |
| Organisms |
Pelophylax saharicus (Sahara frog) (Rana saharica) |
| Prosequence Length (aa) |
25 |
| Functions |
None |
| Preproprotein Length (aa) |
50 |
| Alt Name |
Temporin-1Sc |
| Gene Name |
None |
| NCBI ID |
70019 |
| Cellular Localization |
extracellular region, membrane, other organism cell membrane |
| Processes |
defense response to bacterium, defense response to fungus, innate immune response, killing of cells of other organism |
| PubMed |
18584916
|
| Total Prosequence Length (aa) |
25 |
| Prosequence Location |
11:35 |
| Prosequence Sequence |
EQERDADEEERRDEPDGSNVEVEKR |
| Preproprotein Sequence |
FLGTINLSLCEQERDADEEERRDEPDGSNVEVEKRFLSHIAGFLSNLFGK |