|
PSQ00351 |
FD00001 |
Mu-theraphotoxin-Hhn1b 1 |
D2Y232 |
Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Theraphosidae Haplopelma |
Cyriopagopus hainanus (Chinese bird spider) (Haplopelma hainanum) |
28 |
ion channel inhibitor activity, toxin activity |
86 |
Hainantoxin-4 , Hainantoxin-IV , Peptide F8-18 |
None |
209901 |
extracellular region |
pathogenesis |
12827284, 14512091, 20192277 |
28 |
22:49 |
SESEEKEFSNELLSSVLAVDDNSKGEER |
|
PSQ00352 |
FD00001 |
Mu-theraphotoxin-Hhn1b 2 |
D2Y233 |
Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Theraphosidae Haplopelma |
Cyriopagopus hainanus (Chinese bird spider) (Haplopelma hainanum) |
28 |
ion channel inhibitor activity, toxin activity |
86 |
Hainantoxin-4, Hainantoxin-IV, Peptide F8-18 |
None |
209901 |
extracellular region |
pathogenesis |
12827284, 14512091, 20192277 |
28 |
22:49 |
SESEEKEFSNELLSSVLAVDDNSKGEER |
|
PSQ00353 |
FD00001 |
Omega-theraphotoxin-Hhn1f 1 |
D2Y236 |
Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Theraphosidae Haplopelma |
Cyriopagopus hainanus (Chinese bird spider) (Haplopelma hainanum) |
29 |
ion channel inhibitor activity, toxin activity |
86 |
Hainantoxin-IX, Peptide F1-29 |
None |
209901 |
extracellular region |
pathogenesis |
20192277 |
29 |
22:50 |
SEDAHKELLKEVVRAMVVDKTDAVQAEER |
|
PSQ00354 |
FD00001 |
Omega-theraphotoxin-Hhn1a 1 |
D2Y237 |
Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Theraphosidae Haplopelma |
Cyriopagopus hainanus (Chinese bird spider) (Haplopelma hainanum) |
29 |
ion channel inhibitor activity, toxin activity |
86 |
Hainantoxin-IX-2, Peptide F1-30 |
None |
209901 |
extracellular region |
pathogenesis |
20192277 |
29 |
22:50 |
SEDAHKELLKEVVRAMVVDKTDAVQAEER |
|
PSQ00355 |
FD00001 |
Omega-theraphotoxin-Hhn1a 2 |
D2Y239 |
Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Theraphosidae Haplopelma |
Cyriopagopus hainanus (Chinese bird spider) (Haplopelma hainanum) |
29 |
ion channel inhibitor activity, toxin activity |
86 |
Hainantoxin-IX-2, Peptide F1-30 |
None |
209901 |
extracellular region |
pathogenesis |
20192277 |
29 |
22:50 |
SEDAHKELLKEVVRAMVVDKTDAVQAEER |
|
PSQ00356 |
FD00001 |
U3-theraphotoxin-Hhn1a 1 |
D2Y240 |
Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Theraphosidae Haplopelma |
Cyriopagopus hainanus (Chinese bird spider) (Haplopelma hainanum) |
28 |
ion channel inhibitor activity, toxin activity |
87 |
Hainantoxin-VIII, Peptide F4-27 |
None |
209901 |
extracellular region |
pathogenesis |
20192277 |
28 |
25:52 |
SESEEKEFPKEMLSSIFAVDNDFKQEER |
|
PSQ00357 |
FD00001 |
U3-theraphotoxin-Hhn1a 2 |
D2Y241 |
Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Theraphosidae Haplopelma |
Cyriopagopus hainanus (Chinese bird spider) (Haplopelma hainanum) |
28 |
ion channel inhibitor activity, toxin activity |
87 |
Hainantoxin-VIII, Peptide F4-27 |
None |
209901 |
extracellular region |
pathogenesis |
20192277 |
28 |
25:52 |
SESEEKEFPKEMLSSIFAVDDDFKQEER |
|
PSQ00358 |
FD00001 |
U3-theraphotoxin-Hhn1a 3 |
D2Y242 |
Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Theraphosidae Haplopelma |
Cyriopagopus hainanus (Chinese bird spider) (Haplopelma hainanum) |
28 |
ion channel inhibitor activity, toxin activity |
87 |
Hainantoxin-VIII, Peptide F4-27 |
None |
209901 |
extracellular region |
pathogenesis |
20192277 |
28 |
25:52 |
PESEEKEFPKEMLSSIFAVDNDFKQEER |
|
PSQ00359 |
FD00001 |
U3-theraphotoxin-Hhn1a 4 |
D2Y243 |
Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Theraphosidae Haplopelma |
Cyriopagopus hainanus (Chinese bird spider) (Haplopelma hainanum) |
28 |
ion channel inhibitor activity, toxin activity |
87 |
Hainantoxin-VIII, Peptide F4-27 |
None |
209901 |
extracellular region |
pathogenesis |
20192277 |
28 |
25:52 |
SESEEKEFPKEMLSSIFAVGNDFKQEER |
|
PSQ00360 |
FD00001 |
U3-theraphotoxin-Hhn1a 5 |
D2Y248 |
Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Theraphosidae Haplopelma |
Cyriopagopus hainanus (Chinese bird spider) (Haplopelma hainanum) |
28 |
ion channel inhibitor activity, toxin activity |
87 |
Hainantoxin-VIII, Peptide F4-27 |
None |
209901 |
extracellular region |
pathogenesis |
20192277 |
28 |
25:52 |
SESEEKEFPKEMLSSIFAVDNDFKQEER |
|
PSQ00361 |
FD00001 |
U3-theraphotoxin-Hhn1a 6 |
D2Y249 |
Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Theraphosidae Haplopelma |
Cyriopagopus hainanus (Chinese bird spider) (Haplopelma hainanum) |
28 |
ion channel inhibitor activity, toxin activity |
87 |
Hainantoxin-VIII, Peptide F4-27 |
None |
209901 |
extracellular region |
pathogenesis |
20192277 |
28 |
25:52 |
SESEKKEFPKEMLSSIFAVDNDFKQEER |
|
PSQ00362 |
FD00001 |
U3-theraphotoxin-Hhn1a 7 |
D2Y250 |
Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Theraphosidae Haplopelma |
Cyriopagopus hainanus (Chinese bird spider) (Haplopelma hainanum) |
28 |
ion channel inhibitor activity, toxin activity |
87 |
Hainantoxin-VIII, Peptide F4-27 |
None |
209901 |
extracellular region |
pathogenesis |
20192277 |
28 |
25:52 |
SESEEKEFPKEMLSSIFAVDNDFKQEER |
|
PSQ00363 |
FND00042 |
Hainantoxin-XVIII |
D2Y251 |
Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Theraphosidae Haplopelma |
Cyriopagopus hainanus (Chinese bird spider) (Haplopelma hainanum) |
28 |
toxin activity |
109 |
Peptide F7-35 |
None |
209901 |
extracellular region |
None |
20192277 |
28 |
19:46 |
FPSKDSKAIENDKTEQRMEIVVQETARA |
|
PSQ00364 |
FND00002 |
U11-theraphotoxin-Hhn1a |
D2Y253 |
Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Theraphosidae Haplopelma |
Cyriopagopus hainanus (Chinese bird spider) (Haplopelma hainanum) |
53 |
sodium channel inhibitor activity, toxin activity |
120 |
Hainantoxin-XVI, Peptide F4-19 |
None |
209901 |
extracellular region |
None |
20192277 |
53 |
22:74 |
DKDENRMEMQEKTEQGKSYLDFAENLLLQKLEELEAKLLEEDSEESRNSRQKR |
|
PSQ00365 |
FND00002 |
U11-theraphotoxin-Hhn1a |
D2Y254 |
Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Theraphosidae Haplopelma |
Cyriopagopus hainanus (Chinese bird spider) (Haplopelma hainanum) |
53 |
sodium channel inhibitor activity, toxin activity |
120 |
Hainantoxin-XVI, Peptide F4-19 |
None |
209901 |
extracellular region |
None |
20192277 |
53 |
22:74 |
DKDENRMEVQEKTEQGKSYLDFAENLLLQKLEELEAKLLEEDSEESRNSRQKR |
|
PSQ00366 |
FND00002 |
U11-theraphotoxin-Hhn1a |
D2Y255 |
Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Theraphosidae Haplopelma |
Cyriopagopus hainanus (Chinese bird spider) (Haplopelma hainanum) |
53 |
sodium channel inhibitor activity, toxin activity |
120 |
Hainantoxin-XVI, Peptide F4-19 |
None |
209901 |
extracellular region |
None |
20192277 |
53 |
22:74 |
DKDENRMVMQEKTEQGKSYLDFAENLLLQKLEELEAKLLEEDSEESRNSRQKR |
|
PSQ00367 |
FD00019 |
U11-theraphotoxin-Hhn1a |
D2Y256 |
Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Theraphosidae Haplopelma |
Cyriopagopus hainanus (Chinese bird spider) (Haplopelma hainanum) |
53 |
sodium channel inhibitor activity, toxin activity |
120 |
Hainantoxin-XVI, Peptide F4-19 |
None |
209901 |
extracellular region |
None |
20192277 |
53 |
22:74 |
DKDENRMEMQEKTEQGKGYLDFAENLLPQKLEELEAKLLEEDSEESRNSRQKR |
|
PSQ00368 |
FD00019 |
U11-theraphotoxin-Hhn1a |
D2Y257 |
Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Theraphosidae Haplopelma |
Cyriopagopus hainanus (Chinese bird spider) (Haplopelma hainanum) |
53 |
sodium channel inhibitor activity, toxin activity |
120 |
Hainantoxin-XVI, Peptide F4-19 |
None |
209901 |
extracellular region |
None |
20192277 |
53 |
22:74 |
DKDENRMEMQEKTEQGKSYLDFAENLLLQKLEELEAKPLEEDSEESRNSRQKR |
|
PSQ00369 |
FND00002 |
U11-theraphotoxin-Hhn1a |
D2Y258 |
Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Theraphosidae Haplopelma |
Cyriopagopus hainanus (Chinese bird spider) (Haplopelma hainanum) |
53 |
sodium channel inhibitor activity, toxin activity |
120 |
Hainantoxin-XVI, Peptide F4-19 |
None |
209901 |
extracellular region |
None |
20192277 |
53 |
22:74 |
DKDENRMEMQEKTEQGKSYLDFAENLLLQKLEELEAKLLEEDSEESRNSRQKR |
|
PSQ00370 |
FND00002 |
U11-theraphotoxin-Hhn1a |
D2Y259 |
Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Theraphosidae Haplopelma |
Cyriopagopus hainanus (Chinese bird spider) (Haplopelma hainanum) |
53 |
sodium channel inhibitor activity, toxin activity |
120 |
Hainantoxin-XVI, Peptide F4-19 |
None |
209901 |
extracellular region |
None |
20192277 |
53 |
22:74 |
DKDENRMEMQGKTEQGKSYLDFAENLLLQKLEELEAKLLEEDSEESRNSRQKR |
|
PSQ00371 |
FND00002 |
U11-theraphotoxin-Hhn1a |
D2Y260 |
Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Theraphosidae Haplopelma |
Cyriopagopus hainanus (Chinese bird spider) (Haplopelma hainanum) |
53 |
sodium channel inhibitor activity, toxin activity |
120 |
Hainantoxin-XVI, Peptide F4-19 |
None |
209901 |
extracellular region |
None |
20192277 |
53 |
22:74 |
DKDENRMEMQKKTEQGKSYLDFAENLLLQKLEELEAKLLEEDSEESRNSRQKR |
|
PSQ00372 |
FND00002 |
U11-theraphotoxin-Hhn1a |
D2Y261 |
Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Theraphosidae Haplopelma |
Cyriopagopus hainanus (Chinese bird spider) (Haplopelma hainanum) |
53 |
sodium channel inhibitor activity, toxin activity |
120 |
Hainantoxin-XVI, Peptide F4-19 |
None |
209901 |
extracellular region |
None |
20192277 |
53 |
22:74 |
DKDENRMEMQEKAEQGKSYLDFAENLLLQKLEELEAKLLEEDSEESRNSRQKR |
|
PSQ00373 |
FND00002 |
U11-theraphotoxin-Hhn1a |
D2Y262 |
Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Theraphosidae Haplopelma |
Cyriopagopus hainanus (Chinese bird spider) (Haplopelma hainanum) |
53 |
sodium channel inhibitor activity, toxin activity |
120 |
Hainantoxin-XVI, Peptide F4-19 |
None |
209901 |
extracellular region |
None |
20192277 |
53 |
22:74 |
DKDENRMEMQEKTEQGKSYLDFAENLLLQKLEELEAKLLEEDSEESRNSRQKR |
|
PSQ00374 |
FND00002 |
U11-theraphotoxin-Hhn1a |
D2Y263 |
Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Theraphosidae Haplopelma |
Cyriopagopus hainanus (Chinese bird spider) (Haplopelma hainanum) |
53 |
sodium channel inhibitor activity, toxin activity |
120 |
Hainantoxin-XVI, Peptide F4-19 |
None |
209901 |
extracellular region |
None |
20192277 |
53 |
22:74 |
DKDENRMEMQEKTEQGKSYLDFAENLLLQKLEELEAKLLEEDSEESRNSRQRR |
|
PSQ00375 |
FND00002 |
U11-theraphotoxin-Hhn1a |
D2Y264 |
Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Theraphosidae Haplopelma |
Cyriopagopus hainanus (Chinese bird spider) (Haplopelma hainanum) |
53 |
sodium channel inhibitor activity, toxin activity |
120 |
Hainantoxin-XVI, Peptide F4-19 |
None |
209901 |
extracellular region |
None |
20192277 |
53 |
22:74 |
DKDENRMEMQEKTEQGKSYLDFAENLLLQKLEELEAKLLEEDSEESRNSRQKR |
|
PSQ00376 |
FD00019 |
U11-theraphotoxin-Hhn1a |
D2Y265 |
Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Theraphosidae Haplopelma |
Cyriopagopus hainanus (Chinese bird spider) (Haplopelma hainanum) |
53 |
sodium channel inhibitor activity, toxin activity |
120 |
Hainantoxin-XVI, Peptide F4-19 |
None |
209901 |
extracellular region |
None |
20192277 |
53 |
22:74 |
DKDENRMEMQEKTEQGKSYLDFAENLLLQKLEELVAKLLEEDSEESRNSRQKR |
|
PSQ00377 |
FD00019 |
U11-theraphotoxin-Hhn1a |
D2Y266 |
Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Theraphosidae Haplopelma |
Cyriopagopus hainanus (Chinese bird spider) (Haplopelma hainanum) |
53 |
sodium channel inhibitor activity, toxin activity |
120 |
Hainantoxin-XVI, Peptide F4-19 |
None |
209901 |
extracellular region |
None |
20192277 |
53 |
22:74 |
DKDENRMEMQEKTEQGKSYLDFAENLLLQKLEELKAKLLEEDSEKSRNSRQKR |
|
PSQ00378 |
FND00002 |
U11-theraphotoxin-Hhn1a |
D2Y267 |
Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Theraphosidae Haplopelma |
Cyriopagopus hainanus (Chinese bird spider) (Haplopelma hainanum) |
53 |
sodium channel inhibitor activity, toxin activity |
120 |
Hainantoxin-XVI, Peptide F4-19 |
None |
209901 |
extracellular region |
None |
20192277 |
53 |
22:74 |
DKDENRMEMQEKTEQGKSYLDFAENLLLQKLEELEAKLLEEDSKESRNSRQKR |
|
PSQ00379 |
FND00002 |
U11-theraphotoxin-Hhn1a |
D2Y268 |
Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Theraphosidae Haplopelma |
Cyriopagopus hainanus (Chinese bird spider) (Haplopelma hainanum) |
53 |
sodium channel inhibitor activity, toxin activity |
120 |
Hainantoxin-XVI, Peptide F4-19 |
None |
209901 |
extracellular region |
None |
20192277 |
53 |
22:74 |
DKDENRMEMQEKTEQGKSYLDFAENLLLQKLEELEAKLLEEDSEESRNSRQKR |
|
PSQ00380 |
FND00002 |
U11-theraphotoxin-Hhn1a |
D2Y269 |
Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Theraphosidae Haplopelma |
Cyriopagopus hainanus (Chinese bird spider) (Haplopelma hainanum) |
53 |
sodium channel inhibitor activity, toxin activity |
120 |
Hainantoxin-XVI, Peptide F4-19 |
None |
209901 |
extracellular region |
None |
20192277 |
53 |
22:74 |
DKDENRMEMQEKTEQGKSYLDFAEYLLLQKLEELEAKLLEEDSEESRNSRQKR |
|
PSQ00381 |
FD00019 |
U11-theraphotoxin-Hhn1a |
D2Y270 |
Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Theraphosidae Haplopelma |
Cyriopagopus hainanus (Chinese bird spider) (Haplopelma hainanum) |
53 |
sodium channel inhibitor activity, toxin activity |
120 |
Hainantoxin-XVI, Peptide F4-19 |
None |
209901 |
extracellular region |
None |
20192277 |
53 |
22:74 |
DKDENRMEMQEKTEQGKSYLDFAENLLLQKLEELEAKLPEEDSEESRNSRQKR |
|
PSQ00382 |
FND00002 |
U11-theraphotoxin-Hhn1a |
D2Y292 |
Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Theraphosidae Haplopelma |
Cyriopagopus hainanus (Chinese bird spider) (Haplopelma hainanum) |
53 |
sodium channel inhibitor activity, toxin activity |
120 |
Hainantoxin-XVI, Peptide F4-19 |
None |
209901 |
extracellular region |
None |
20192277 |
53 |
22:74 |
DKDENRMEMQEKTEQGKSYLDFAENLLLQKLEELEAKLLEEDSEESRNSRQKR |
|
PSQ00383 |
FND00002 |
U11-theraphotoxin-Hhn1a |
D2Y293 |
Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Theraphosidae Haplopelma |
Cyriopagopus hainanus (Chinese bird spider) (Haplopelma hainanum) |
53 |
sodium channel inhibitor activity, toxin activity |
120 |
Hainantoxin-XVI, Peptide F4-19 |
None |
209901 |
extracellular region |
None |
20192277 |
53 |
22:74 |
DKDENRMEMQEKTEQGKSYLDFAENLLLQKLEELEAKLLEEDSEESRNSRQKR |
|
PSQ00384 |
FND00002 |
U11-theraphotoxin-Hhn1a |
D2Y294 |
Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Theraphosidae Haplopelma |
Cyriopagopus hainanus (Chinese bird spider) (Haplopelma hainanum) |
53 |
sodium channel inhibitor activity, toxin activity |
120 |
Hainantoxin-XVI, Peptide F4-19 |
None |
209901 |
extracellular region |
None |
20192277 |
53 |
22:74 |
DKEENRMEMQEKTEQGKSYLDFAENLLLQKLEELEAKLLEEDSEESRNSRQKR |
|
PSQ00385 |
FND00002 |
U11-theraphotoxin-Hhn1a |
D2Y295 |
Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Theraphosidae Haplopelma |
Cyriopagopus hainanus (Chinese bird spider) (Haplopelma hainanum) |
53 |
sodium channel inhibitor activity, toxin activity |
120 |
Hainantoxin-XVI, Peptide F4-19 |
None |
209901 |
extracellular region |
None |
20192277 |
53 |
22:74 |
DKDENRMEMQEKTEQGKSYLDFAENLLLQKLEELEAKLLEEDSEESRNSRQKR |
|
PSQ00386 |
FD00019 |
U11-theraphotoxin-Hhn1a |
D2Y296 |
Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Theraphosidae Haplopelma |
Cyriopagopus hainanus (Chinese bird spider) (Haplopelma hainanum) |
53 |
sodium channel inhibitor activity, toxin activity |
120 |
Hainantoxin-XVI, Peptide F4-19 |
None |
209901 |
extracellular region |
None |
20192277 |
53 |
22:74 |
DKDESRMEMQEKTEQGKSYLDFAENLLPQKLEELEAKLLEEDSEESRNSRQKR |
|
PSQ00387 |
FND00002 |
U11-theraphotoxin-Hhn1a |
D2Y297 |
Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Theraphosidae Haplopelma |
Cyriopagopus hainanus (Chinese bird spider) (Haplopelma hainanum) |
53 |
sodium channel inhibitor activity, toxin activity |
120 |
Hainantoxin-XVI, Peptide F4-19 |
None |
209901 |
extracellular region |
None |
20192277 |
53 |
22:74 |
DKDENRMEMQEKTEQGRSYLDFAENLLLQKLEELEAKLLEEDSEESRNSRQKR |
|
PSQ00388 |
FND00002 |
U11-theraphotoxin-Hhn1a |
D2Y298 |
Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Theraphosidae Haplopelma |
Cyriopagopus hainanus (Chinese bird spider) (Haplopelma hainanum) |
53 |
sodium channel inhibitor activity, toxin activity |
120 |
Hainantoxin-XVI, Peptide F4-19 |
None |
209901 |
extracellular region |
None |
20192277 |
53 |
22:74 |
DKDENRMEMQEKTEQGESYLDFAENLLLQKLEELEAKLLEEDSEESRNSRQKR |
|
PSQ00389 |
FND00002 |
U9-theraphotoxin-Hhn1a |
D2Y299 |
Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Theraphosidae Haplopelma |
Cyriopagopus hainanus (Chinese bird spider) (Haplopelma hainanum) |
54 |
sodium channel inhibitor activity, toxin activity |
120 |
Hainantoxin-XIX |
None |
209901 |
extracellular region |
None |
20192277 |
54 |
22:75 |
DEDGNRMEMRQEIEKTEADSSYFAENLLLQKLEELEAKLWEETSEESRNSRQKR |
|
PSQ00390 |
FD00001 |
U5-theraphotoxin-Hhn1a |
D2Y2C3 |
Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Theraphosidae Haplopelma |
Cyriopagopus hainanus (Chinese bird spider) (Haplopelma hainanum) |
28 |
ion channel inhibitor activity, toxin activity |
85 |
Hainantoxin-VII , Peptide F4-32 |
None |
209901 |
extracellular region |
pathogenesis |
20192277 |
28 |
22:49 |
SKSKEQDLRDALFSAMFSADNQLNPQER |
|
PSQ00391 |
FND00032 |
Hainantoxin-XVII |
D2Y2C5 |
Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Theraphosidae Haplopelma |
Cyriopagopus hainanus (Chinese bird spider) (Haplopelma hainanum) |
24 |
toxin activity |
98 |
Peptide F2-20 |
None |
209901 |
extracellular region |
None |
20192277 |
24 |
41:64 |
QHPGFQELLILEENMRDPENSKER |
|
PSQ00392 |
FND00032 |
Hainantoxin-XVII |
D2Y2C7 |
Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Theraphosidae Haplopelma |
Cyriopagopus hainanus (Chinese bird spider) (Haplopelma hainanum) |
24 |
toxin activity |
98 |
Peptide F2-20 |
None |
209901 |
extracellular region |
None |
20192277 |
24 |
41:64 |
QHPGFQELLILEENMRDPENSKER |
|
PSQ00393 |
FND00032 |
Hainantoxin-XVII |
D2Y2C8 |
Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Theraphosidae Haplopelma |
Cyriopagopus hainanus (Chinese bird spider) (Haplopelma hainanum) |
24 |
toxin activity |
98 |
Peptide F2-20 |
None |
209901 |
extracellular region |
None |
20192277 |
24 |
41:64 |
QHPGFQELLILEENMRDPENSKER |
|
PSQ00394 |
FD00001 |
Hainantoxin-III 9 |
D2Y2D1 |
Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Theraphosidae Haplopelma |
Cyriopagopus hainanus (Chinese bird spider) (Haplopelma hainanum) |
27 |
ion channel inhibitor activity, toxin activity |
83 |
Hainantoxin-3, Mu-theraphotoxin-Hhn2a, Peptide F7-18 |
None |
209901 |
extracellular region |
pathogenesis |
14512091, 20192277 |
27 |
22:48 |
SESEEKEFPIELLSKIFAVDVFKGEER |
|
PSQ00395 |
FD00001 |
Hainantoxin-III 10 |
D2Y2D2 |
Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Theraphosidae Haplopelma |
Cyriopagopus hainanus (Chinese bird spider) (Haplopelma hainanum) |
27 |
ion channel inhibitor activity, toxin activity |
83 |
Hainantoxin-3, Mu-theraphotoxin-Hhn2a, Peptide F7-18 |
None |
209901 |
extracellular region |
pathogenesis |
14512091, 20192277 |
27 |
22:48 |
SESEEKEFPRELLSKIFAVDDFKGEER |
|
PSQ00396 |
FD00001 |
Hainantoxin-III 11 |
D2Y2D3 |
Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Theraphosidae Haplopelma |
Cyriopagopus hainanus (Chinese bird spider) (Haplopelma hainanum) |
27 |
ion channel inhibitor activity, toxin activity |
83 |
Hainantoxin-3, Mu-theraphotoxin-Hhn2a, Peptide F7-18 |
None |
209901 |
extracellular region |
pathogenesis |
14512091, 20192277 |
27 |
22:48 |
SESEEKDFPRELLSKIFAVDDFKGEER |
|
PSQ00397 |
FND00003 |
U4-theraphotoxin-Hhn1a |
D2Y2D5 |
Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Theraphosidae Haplopelma |
Cyriopagopus hainanus (Chinese bird spider) (Haplopelma hainanum) |
26 |
toxin activity |
85 |
Hainantoxin-II, Peptide F8-20 |
None |
209901 |
extracellular region, host cell postsynaptic membrane |
pathogenesis |
20192277, 21174344 |
26 |
23:48 |
EELEAESQLMEVGMPDTELAAVDEER |
|
PSQ00398 |
FD00001 |
Mu-theraphotoxin-Hhn1b 3 |
D2Y2D7 |
Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Theraphosidae Haplopelma |
Cyriopagopus hainanus (Chinese bird spider) (Haplopelma hainanum) |
28 |
ion channel inhibitor activity, toxin activity |
86 |
Hainantoxin-4, Hainantoxin-IV, Peptide F8-18 |
None |
209901 |
extracellular region |
pathogenesis |
12827284, 14512091, 20192277 |
28 |
22:49 |
SESEEKEFSNELLSSVLAVDDNSKGEER |
|
PSQ00399 |
FD00001 |
Omega-theraphotoxin-Hhn1f 2 |
D2Y2E8 |
Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Theraphosidae Haplopelma |
Cyriopagopus hainanus (Chinese bird spider) (Haplopelma hainanum) |
29 |
ion channel inhibitor activity, toxin activity |
86 |
Hainantoxin-IX, Peptide F1-29 |
None |
209901 |
extracellular region |
pathogenesis |
20192277 |
29 |
22:50 |
SEDAHKELLKEVVRAVVVDKTDAVQAEER |
|
PSQ00400 |
FD00001 |
Omega-theraphotoxin-Hhn1f 3 |
D2Y2E9 |
Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Theraphosidae Haplopelma |
Cyriopagopus hainanus (Chinese bird spider) (Haplopelma hainanum) |
29 |
ion channel inhibitor activity, toxin activity |
86 |
Hainantoxin-IX, Peptide F1-29 |
None |
209901 |
extracellular region |
pathogenesis |
20192277 |
29 |
22:50 |
SEDAHKELLKEVVRAMVVDKTDAVQAEER |