Details of PSQ01516
| ProSeqID |
PSQ01516 |
| Family |
FD00042 |
| Protein Name |
Osteocalcin |
| UniProt ID |
P84349
|
| Taxonomy |
Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Mammalia-Eutheria-Euarchontoglires-Primates-Haplorrhini-Catarrhini-Hominidae-Gorilla |
| Organisms |
Gorilla gorilla gorilla (Western lowland gorilla) |
| Prosequence Length (aa) |
28 |
| Functions |
calcium ion binding, hydroxyapatite binding, structural constituent of bone |
| Preproprotein Length (aa) |
100 |
| Alt Name |
Bone Gla protein, Gamma-carboxyglutamic acid-containing protein |
| Gene Name |
BGLAP |
| NCBI ID |
9595 |
| Cellular Localization |
cytoplasm, extracellular region |
| Processes |
biomineral tissue development, bone development, osteoblast differentiation, regulation of bone mineralization, regulation of cellular response to insulin stimulus, response to vitamin D, response to vitamin K |
| PubMed |
15753298
|
| Total Prosequence Length (aa) |
28 |
| Prosequence Location |
24:51 |
| Prosequence Sequence |
KPSGAESSKGAAFVSKQEGSEVVKRPRR |
| Preproprotein Sequence |
MRALTLLALLALAALCIAGQAGAKPSGAESSKGAAFVSKQEGSEVVKRPRRYLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV |