Home Advance Search BLAST Contact Documentation/Help Feedback

Details of PSQ00573

ProSeqID PSQ00573
Family FD00143
Protein Name Spexin prohormone 1
UniProt ID I7C2V3
Taxonomy Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Actinopterygii-Neopterygii-Teleostei-Ostariophysi-Cypriniformes-Cyprinidae-Cyprininae-Carassius
Organisms Carassius auratus (Goldfish)
Prosequence Length (aa) 9
Functions neuropeptide hormone activity, type 2 galanin receptor binding, type 3 galanin receptor binding
Preproprotein Length (aa) 102
Alt Name Spexin hormone
Gene Name spx
NCBI ID 7957
Cellular Localization extracellular space, transport vesicle
Processes long-chain fatty acid import into cell, negative regulation of appetite, negative regulation of heart rate, negative regulation of renal sodium excretion, positive regulation of systemic arterial blood pressure, positive regulation of transcription by RNA polymerase II, regulation of sensory perception of pain
PubMed 23715729
Total Prosequence Length (aa) 9
Prosequence Location 27:35
Prosequence Sequence APMGSFQRR
Preproprotein Sequence MKDLRTLAAYALALLLLATFVSYSRSAPMGSFQRRNWTPQAMLYLKGTQGRRFVSEDRNEGDLYDTIRLESQSQNTENLSISKAAAFLLNVLQQARDEGEPY