Home Advance Search BLAST Contact Documentation/Help Feedback
Family
Protein Name
Uniprot ID
Taxonomy
Organism
Prosequence length
Functions
PreProtein length
Alt Name
Gene Name
NCBI ID
Cell Org
Process
PubMed
Total Proseq length
Proseq Loc
Prosequence Sequence

Proseq ID Family Protein Name Uniprot ID Taxonomy Organism Prosequence length Functions PreProtein length Alter Name Gene Name NCBI ID Cell Org Process PubMed Total Proseq length Proseq Loc Prosequence Sequence
PSQ00544 FD00025 Cliotide T8 G1CWH6 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids fabids Fabales Fabaceae Papilionoideae 50 kb inversion clade NPAAA clade indigoferoid/millettioid clade Phaseoleae Clitoria Clitoria ternatea (Butterfly pea) 67 None 122 None None 43366 None defense response 21596752 67 56:122 HVIAAEANSVDDHHLLCQSHDDCIKKGTGNFCAPFLDHAVQYGWCFRAESEGYLLKDFLKMPKALTN
PSQ00545 FD00025 Cliotide T12 G1CWH8 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids fabids Fabales Fabaceae Papilionoideae 50 kb inversion clade NPAAA clade indigoferoid/millettioid clade Phaseoleae Clitoria Clitoria ternatea (Butterfly pea) 65 None 123 None None 43366 None defense response 21596752 65 59:123 HVIAAEAKTMDDHHLLCQSHEDCITKGTGNFCASFPEQDIKYGWCFRAESEGFMLKDHLKMSVPN
PSQ00556 FD00160 Acid beta-fructofuranosidase 1 H2DF87 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids fabids Rosales Rosaceae Rosoideae Rosoideae incertae sedis Rosa Rosa hybrid cultivar 115 sucrose alpha-glucosidase activity 588 Vacuolar invertase 1 None 128735 integral component of membrane, vacuolar lumen carbohydrate metabolic process 27083698 115 1:115 MDTSTSAYAPLPGEDPLFSGHPPASLRRSWKGFAVIFASVLFLLSLVGLIIHQGPQQPPDVMPDKQDEHHHPQSTTPASETTASWEPRGKALGVSAKSNPPVSDELSYNWTNAMF
PSQ00558 FD00034 Chassatide C2 I0B6F2 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae asterids lamiids Gentianales Rubiaceae Rubioideae Palicoureeae Chassalia Chassalia chartacea 20 None 77 Cyclotide chaC2 None 510798 None cytolysis, defense response 22467870 20 25:44 SDTIKVPDLGKRLLMNRDPN
PSQ00559 FND00217 Chassatide C4 I0B6F3 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae asterids lamiids Gentianales Rubiaceae Rubioideae Palicoureeae Chassalia Chassalia chartacea 19, 7 None 78 Cyclotide chaC4 None 510798 None defense response 22467870;22467870 26 24:42, 72:78 IVIMQDPDLGRKLIMNPAN, GLNPESI
PSQ00560 FD00034 Chassatide C7 I0B6F4 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae asterids lamiids Gentianales Rubiaceae Rubioideae Palicoureeae Chassalia Chassalia chartacea 35 None 64 Cyclotide chaC7 None 510798 None defense response to Gram-negative bacterium, hemolysis in other organism 22467870 35 1:35 VLVASLVMLEAQSSDTIQVPDWGKRLLMNHDSNRV
PSQ00561 FD00034 Chassatide C8 I0B6F5 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae asterids lamiids Gentianales Rubiaceae Rubioideae Palicoureeae Chassalia Chassalia chartacea 21 None 75 Cyclotide chaC8 None 510798 None defense response to Gram-negative bacterium, hemolysis in other organism 22467870 21 25:45 SDTIKAPDWGKRLLMNHDSDL
PSQ00562 FD00034 Chassatide C13 I0B6G2 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae asterids lamiids Gentianales Rubiaceae Rubioideae Palicoureeae Chassalia Chassalia chartacea 20 None 77 Cyclotide chaC13 None 510798 None defense response 22467870 20 25:44 SNTFQVPDLGKRLLMNRDPN
PSQ00597 FD00164 Anionic peroxidase O04795 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae asterids lamiids Solanales Convolvulaceae Ipomoeeae Ipomoea Ipomoea batatas (Sweet potato) (Convolvulus batatas) 46 heme binding, metal ion binding, peroxidase activity 364 SwPA1 None 4120 extracellular region hydrogen peroxide catabolic process, response to oxidative stress 9267434 46 21:66 GCAVYQNTQTAMKDQLKVTPTWLDNTLKSTNLLSLGLGKPSGGKLG
PSQ00598 FD00164 Neutral peroxidase O04796 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae asterids lamiids Solanales Convolvulaceae Ipomoeeae Ipomoea Ipomoea batatas (Sweet potato) (Convolvulus batatas) 47 heme binding, metal ion binding, peroxidase activity 348 SwPN1 None 4120 extracellular region hydrogen peroxide catabolic process, response to oxidative stress 9267434 47 21:67 GYSLVQNTLSSPTHTRLNLIPTWLDSTFDSADVLSYLGFGKSSGRLS
PSQ00608 FD00107 Vacuolar-processing enzyme O24325 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids fabids Fabales Fabaceae Papilionoideae 50 kb inversion clade NPAAA clade indigoferoid/millettioid clade Phaseoleae Phaseolus Phaseolus vulgaris (Kidney bean) (French bean) 20 cysteine-type endopeptidase activity 484 Legumain-like proteinase None 3885 None proteolysis involved in cellular protein catabolic process 9874222 20 25:44 GRDLVGDFLRLPSDSGNGDN
PSQ00618 FD00464 L-galactono-1,4-lactone dehydrogenase, mitochondrial O47881 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Brassiceae Brassica Brassica oleracea (Wild cabbage) 66 D-arabinono-1,4-lactone oxidase activity, FAD binding, galactonolactone dehydrogenase activity, L-gulono-1,4-lactone dehydrogenase activity 600 None None 3712 integral component of membrane, mitochondrial membrane, plastid L-ascorbic acid biosynthetic process 9374475 66 26:91 CTSGQTLTPAPPPPPPPPPPISSSASEKEFRKYAGYAALALFSGAATYFSFPFPENAKHKKAQIFR
PSQ00628 FD00056 Subtilisin-like protease SBT1 O65351 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) 82 serine-type endopeptidase activity 757 Cucumisin-like serine protease, Subtilase subfamily 1 member 7 , Subtilisin-like serine protease 1 SBT1 3702 apoplast, cell wall, extracellular region, secretory vesicle mucilage extrusion from seed coat, mucilage metabolic process involved in seed coat development, seed coat development 12413398, 9188482 82 25:106 SSSDQGTYIVHMAKSQMPSSFDLHSNWYDSSLRSISDSAELLYTYENAIHGFSTRLTQEEADSLMTQPGVISVLPEHRYELH
PSQ00637 FND00223 Precursor of CEP3 O80460 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) 39 hormone activity 82 None CEP3 3702 apoplast, extracellular region cellular response to nitrogen starvation, nitrate import, regulation of lateral root development, regulation of leaf morphogenesis, regulation of root development, regulation of shoot system development, response to auxin, response to carbon dioxide, response to light intensity, response to nitrate starvation, response to nitrogen compound, response to osmotic stress, response to potassium ion, response to salt stress, response to sucrose, response to temperature stimulus, root development 25324386 39 25:63 RKLTKFTVTTSEEIRAGGSVLSSSPPTEPLESPPSHGVD
PSQ00638 FD00086 Arabinogalactan protein 16 O82337 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) 36 None 73 Arabinogalactan peptide 16 AGP16 3702 anchored component of membrane, plasma membrane None 11006345, 15322080 36 38:73 DGTSIDQGIAYLLMVVALVLTYLIHPLDASSSYSFF
PSQ00639 FD00056 Subtilisin-like protease SBT3 O82777 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae asterids lamiids Solanales Solanaceae Solanoideae Solaneae Solanum Solanum subgen Lycopersicon Solanum lycopersicum (Tomato) (Lycopersicon esculentum) 90 identical protein binding, protein homodimerization activity, serine-type endopeptidase activity, serine-type peptidase activity 761 LeSBT3 , SlSBT3 , Subtilase 3 sbt3 4081 extracellular space defense response, peptide catabolic process, plant-type cell wall modification, positive regulation of defense response to insect, positive regulation of gene expression, proteolysis, regulation of cell wall pectin metabolic process, response to wounding, self proteolysis 19332543 90 23:112 QRSTYIVHLDKSLMPNVFTDHHHWHSSTIDSIKASVPSSVDRFHSAPKLVYSYDNVLHGFSAVLSKDELAALKKLPGFISAYKDRTVEPH
PSQ00691 FD00012 Papain P00784 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Caricaceae Carica Carica papaya (Papaya) 115 cysteine-type peptidase activity, serpin family protein binding 345 Papaya proteinase I None 3649 None None 5470818 115 19:133 VYMGLSFGDFSIVGYSQNDLTSTERLIQLFESWMLKHNKIYKNIDEKIYRFEIFKDNLKYIDETNKKNNSYWLGLNVFADMSNDEFKEKYTGSIAGNYTTTELSYEEVLNDGDVN
PSQ00692 FD00012 Actinidain P00785 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae asterids Ericales Actinidiaceae Actinidia Actinidia chinensis var 102 cysteine-type endopeptidase activity 380 None ACT1A 1590841 None None 18442249, 687380 102 25:126 FNAKNLTQRTNDEVKAMYESWLIKYGKSYNSLGEWERRFEIFKETLRFIDEHNADTNRSYKVGLNQFADLTDEEFRSTYLGFTSGSNKTKVSNQYEPRVGQV
PSQ00700 FD00110 Bowman-Birk type proteinase inhibitor P01055 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids fabids Fabales Fabaceae Papilionoideae 50 kb inversion clade NPAAA clade indigoferoid/millettioid clade Phaseoleae Glycine Glycine subgen Soja Glycine max (Soybean) (Glycine hispida) 20 serine-type endopeptidase inhibitor activity 110 None None 3847 extracellular region None 4672481 20 20:39 ANLRLSKLGLLMKSDHQHSN
PSQ00701 FD00110 Bowman-Birk type proteinase inhibitor C-II P01063 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids fabids Fabales Fabaceae Papilionoideae 50 kb inversion clade NPAAA clade indigoferoid/millettioid clade Phaseoleae Glycine Glycine subgen Soja Glycine max (Soybean) (Glycine hispida) 7 serine-type endopeptidase inhibitor activity 83 None None 3847 extracellular region None 599141 7 1:7 MELNLFK
Go to Lab Web Page