| ProSeqID | PSQ00637 |
| Family | FND00223 |
| Protein Name | Precursor of CEP3 |
| UniProt ID | O80460 |
| Taxonomy | Eukaryota-Viridiplantae-Streptophyta-Embryophyta-Tracheophyta-Spermatophyta-Magnoliopsida-Eudicotyledons-Gunneridae-Pentapetalae-Rosids-Malvids-Brassicales-Brassicaceae-Camelineae-Arabidopsis |
| Organisms | Arabidopsis thaliana (Mouse-ear cress) |
| Prosequence Length (aa) | 39 |
| Functions | hormone activity |
| Preproprotein Length (aa) | 82 |
| Alt Name | None |
| Gene Name | CEP3 |
| NCBI ID | 3702 |
| Cellular Localization | apoplast, extracellular region |
| Processes | cellular response to nitrogen starvation, nitrate import, regulation of lateral root development, regulation of leaf morphogenesis, regulation of root development, regulation of shoot system development, response to auxin, response to carbon dioxide, response to light intensity, response to nitrate starvation, response to nitrogen compound, response to osmotic stress, response to potassium ion, response to salt stress, response to sucrose, response to temperature stimulus, root development |
| PubMed | 25324386 |
| Total Prosequence Length (aa) | 39 |
| Prosequence Location | 25:63 |
| Prosequence Sequence | RKLTKFTVTTSEEIRAGGSVLSSSPPTEPLESPPSHGVD |
| Preproprotein Sequence | MATINVYVFAFIFLLTISVGSIEGRKLTKFTVTTSEEIRAGGSVLSSSPPTEPLESPPSHGVDTFRPTEPGHSPGIGHSVHN |