Home Advance Search BLAST Contact Documentation/Help Feedback
Family
Protein Name
Uniprot ID
Taxonomy
Organism
Prosequence length
Functions
PreProtein length
Alt Name
Gene Name
NCBI ID
Cell Org
Process
PubMed
Total Proseq length
Proseq Loc
Prosequence Sequence

Proseq ID Family Protein Name Uniprot ID Taxonomy Organism Prosequence length Functions PreProtein length Alter Name Gene Name NCBI ID Cell Org Process PubMed Total Proseq length Proseq Loc Prosequence Sequence
PSQ01881 FD00174 Polygalacturonase Q7M1E7 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Pinopsida Pinidae Cupressales Cupressaceae Chamaecyparis Chamaecyparis obtusa (Hinoki false-cypress) (Retinospora obtusa) 28 polygalacturonase activity 514 Major pollen allergen Cha o 2, Pectinase None 13415 cell wall, extracellular region carbohydrate metabolic process, cell wall organization, fruit ripening 10486272 28 23:50 EDQSAQIMLDSDIEQYLRSNRSLKKLVH
PSQ01895 FND00328 Hydroxyproline-rich systemin Q7XAD0 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae asterids lamiids Solanales Solanaceae Solanoideae Solaneae Solanum Solanum subgen Lycopersicon Solanum lycopersicum (Tomato) (Lycopersicon esculentum) 24, 25, 16 hormone activity, signaling receptor binding 146 Defense-signaling glycopeptide hormone None 4081 extracellular region defense response 12748180;12748180;12748180 65 25:48, 86:110, 131:146 RTLLGNYHDDEMLIELKLESGNYG, PIIGQLTTITTTPHHDDTVAAPPVG, IIITSSSSTLPLQASY
PSQ01941 FND00196 Precursor of CEP1 Q8L8Y3 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) 43 hormone activity 91 None CEP1 3702 apoplast, extracellular region, extracellular space cell-cell signaling involved in cell fate commitment, cellular response to ammonium ion, cellular response to nitrogen starvation, lateral root development, negative regulation of cell division, negative regulation of cell growth, nitrate import, photoperiodism, flowering, regulation of leaf morphogenesis, regulation of root development, response to auxin, response to nitrate starvation, response to nitrogen compound, response to osmotic stress, response to salt stress, root development 25324386 43 29:71 RHLKTTSLEIEGIYKKTEAEHPSIVVTYTRRGVLQKEVIAHPT
PSQ01942 FD00086 Arabinogalactan protein 41 Q8L9T8 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) 25 None 63 Arabinogalactan peptide 41 AGP41 3702 anchored component of membrane, plasma membrane None 15322080 25 39:63 DGTTIDQGIAYVLMLVALVLTYLIH
PSQ01943 FND00287 Arabinogalactan protein 40 Q8LD43 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) 27 None 62 Arabinogalactan peptide 40 AGP40 3702 anchored component of membrane, plasma membrane None 15322080 27 36:62 SASTVAFPVVGSIVAASLSAFLALLLQ
PSQ01944 FD00054 Endonuclease 3 Q8LDW6 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) 16 endonuclease activity, endoribonuclease activity, metal ion binding, nucleic acid binding, single-stranded DNA endodeoxyribonuclease activity 300 Deoxyribonuclease ENDO3 , Single-stranded-nucleate endonuclease ENDO3 ENDO3 3702 None DNA catabolic process, RNA phosphodiester bond hydrolysis, endonucleolytic 23620482 16 279:294 GTLNRIFSAKRKLARA
PSQ01945 FD00379 Long chain acyl-CoA synthetase 6 Q8LPS1 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) 38 ATP binding, long-chain fatty acid-CoA ligase activity 701 None LACS6 3702 cytosol, endoplasmic reticulum, glyoxysomal membrane, membrane, peroxisome fatty acid metabolic process, multicellular organism development, response to ozone 12481085 38 1:38 MDSSSSSSSAAARRRINAIHSHLVTSSRSSPLLRSNPT
PSQ01957 FND00264 Arabinogalactan protein 23 Q8S2W4 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) 26 None 61 Arabinogalactan peptide 23 AGP23 3702 anchored component of membrane, plasma membrane None 15322080 26 36:61 AASAALPALGSLVGASLVSLFSYYLH
PSQ01962 FD00221 Bowman-Birk type proteinase inhibitor Q8W4Y8 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids fabids Fabales Fabaceae Papilionoideae 50 kb inversion clade NPAAA clade Hologalegina IRL clade Fabeae Lens Lens culinaris (Lentil) (Cicer lens) 14 serine-type endopeptidase inhibitor activity 110 LCTI, Trypsin None 3864 extracellular region None 15212472, 16889634 14 29:42 RFDSTSFITQVLSN
PSQ01983 FND00048 Hydroxyproline-rich systemin B Q93WP7 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae asterids lamiids Solanales Solanaceae Nicotianoideae Nicotianeae Nicotiana Nicotiana tabacum (Common tobacco) 17, 89 hormone activity 164 None None 4097 extracellular region defense response 11459063;11459063 106 19:35, 54:142 RTLLENHEGLNVGSGYG, VSNSVSPTRTDEKTSENTELVMTTIAQGENSNQLFPFLTSSDNYQLASFKKLSISYLLPVSYVWKLISSSSFNHDLVDIFDTSSDEKYW
PSQ01984 FND00048 Hydroxyproline-rich systemin A Q93WP8 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae asterids lamiids Solanales Solanaceae Nicotianoideae Nicotianeae Nicotiana Nicotiana tabacum (Common tobacco) 17, 90 hormone activity 165 None None 4097 extracellular region defense response 11459063;11459063 107 19:35, 54:143 RTLLENHEGLNVGSGYG, VSNSVSPTRTDEKTSENTELVMTTIAQGENINQLFSFPTSADNYYQLASFKKLFISYLLPVSYVWNLIGSSSFDHDLVDIFDSKSDERYW
PSQ01985 FD00385 Snakin-2 Q93X17 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae asterids lamiids Solanales Solanaceae Solanoideae Solaneae Solanum Solanum tuberosum (Potato) 15 None 104 None SN2 4113 cell wall, extracellular region defense response 11891250 15 24:38 IQTDQVTSNAISEAA
PSQ01986 FD00381 Stachyose synthase Q93XK2 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids fabids Fabales Fabaceae Papilionoideae 50 kb inversion clade NPAAA clade Hologalegina IRL clade Fabeae Pisum Pisum sativum (Garden pea) 11 galactinol-raffinose galactosyltransferase activity 853 Galactinol--raffinose galactosyltransferase STS1 3888 cytoplasm oligosaccharide biosynthetic process, stachyose biosynthetic process 11675396 11 1:11 MAPPLNSTTSN
PSQ01987 FD00366 Rapid alkalinization factor Q945T0 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae asterids lamiids Solanales Solanaceae Nicotianoideae Nicotianeae Nicotiana Nicotiana tabacum (Common tobacco) 43 hormone activity, receptor ligand activity 120 None RALF 4097 extracellular region, plasmodesma calcium-mediated signaling, regulation of signaling receptor activity 11675511 43 24:66 GDSGAYDWVMPARSGGGCKGSIGECIAEEEEFELDSESNRRIL
PSQ01989 FD00082 Cathepsin B-like protease 3 Q94K85 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) 76, 17 cysteine-type endopeptidase activity 360 Cathepsin B3 CATHB3 3702 cytosol, extracellular space, lysosome, secretory vesicle, vacuole defense response, proteolysis involved in cellular protein catabolic process, regulation of catalytic activity 27058316;27058316 93 27:102, 343:359 GIEAESLTKQKLDSKILQDEIVKKVNENPNAGWKAAINDRFSNATVAEFKRLLGVKPTPKKHFLGVPIVSHDPSLK, NVFRVDTGSNDLPVASV
PSQ02004 FD00310 Lectin-B Q9AVB0 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae Caryophyllales Phytolaccaceae Phytolacca Phytolacca americana (American pokeweed) (Phytolacca decandra) 15, 25 carbohydrate binding, chitin binding 361 PL-B None 3527 None positive regulation of cell division, positive regulation of mitotic nuclear division 9145528;9145528 40 27:41, 337:361 HEGHGVVELIMGKLG, SLPSPLSQILAIRKLNATIPTMAVE
PSQ02005 FD00318 Lectin-C Q9AYP9 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae Caryophyllales Phytolaccaceae Phytolacca Phytolacca americana (American pokeweed) (Phytolacca decandra) 18, 24 carbohydrate binding, chitin binding 194 PL-C None 3527 None positive regulation of cell division, positive regulation of mitotic nuclear division 7670205;7670205 42 27:44, 171:194 QGHEGHGVGEILLMGKLG, LLPSPLRRIIAIRKLKANLANMLS
PSQ02013 FND00047 Arabinogalactan protein 21 Q9C8A4 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) 22 None 60 Arabinogalactan peptide 21 AGP21 3702 anchored component of membrane, plasma membrane None 15322080 22 37:58 DAAMFVPALFASVVALASGFIF
PSQ02014 FD00054 Endonuclease 2 Q9C9G4 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) 8 double-stranded DNA exodeoxyribonuclease activity, endonuclease activity, endoribonuclease activity, metal ion binding, nucleic acid binding, single-stranded DNA endodeoxyribonuclease activity, T/G mismatch-specific endonuclease activity 290 Deoxyribonuclease ENDO2 , Single-stranded-nucleate endonuclease ENDO2 ENDO2 3702 None DNA catabolic process, RNA phosphodiester bond hydrolysis, endonucleolytic 23620482 8 283:290 ATLNRIFG
PSQ02023 FD00028 2S seed storage protein 5 Q9FH31 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) 19 nutrient reservoir activity 165 Seed storage albumin 5 SESA5 3702 None pollen development 8310078 19 71:89 YEADDFELTLDVDLEDDEN