Proseq ID | Family | Protein Name ![]() |
Uniprot ID | Taxonomy | Organism | Prosequence length![]() |
Functions | PreProtein length | Alter Name | Gene Name | NCBI ID | Cell Org | Process | PubMed | Total Proseq length | Proseq Loc | Prosequence Sequence | |
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
PSQ01881 | FD00174 | Polygalacturonase | Q7M1E7 | Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Pinopsida Pinidae Cupressales Cupressaceae Chamaecyparis | Chamaecyparis obtusa (Hinoki false-cypress) (Retinospora obtusa) | 28 | polygalacturonase activity | 514 | Major pollen allergen Cha o 2, Pectinase | None | 13415 | cell wall, extracellular region | carbohydrate metabolic process, cell wall organization, fruit ripening | 10486272 | 28 | 23:50 | EDQSAQIMLDSDIEQYLRSNRSLKKLVH | |
PSQ01895 | FND00328 | Hydroxyproline-rich systemin | Q7XAD0 | Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae asterids lamiids Solanales Solanaceae Solanoideae Solaneae Solanum Solanum subgen Lycopersicon | Solanum lycopersicum (Tomato) (Lycopersicon esculentum) | 24, 25, 16 | hormone activity, signaling receptor binding | 146 | Defense-signaling glycopeptide hormone | None | 4081 | extracellular region | defense response | 12748180;12748180;12748180 | 65 | 25:48, 86:110, 131:146 | RTLLGNYHDDEMLIELKLESGNYG, PIIGQLTTITTTPHHDDTVAAPPVG, IIITSSSSTLPLQASY | |
PSQ01941 | FND00196 | Precursor of CEP1 | Q8L8Y3 | Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis | Arabidopsis thaliana (Mouse-ear cress) | 43 | hormone activity | 91 | None | CEP1 | 3702 | apoplast, extracellular region, extracellular space | cell-cell signaling involved in cell fate commitment, cellular response to ammonium ion, cellular response to nitrogen starvation, lateral root development, negative regulation of cell division, negative regulation of cell growth, nitrate import, photoperiodism, flowering, regulation of leaf morphogenesis, regulation of root development, response to auxin, response to nitrate starvation, response to nitrogen compound, response to osmotic stress, response to salt stress, root development | 25324386 | 43 | 29:71 | RHLKTTSLEIEGIYKKTEAEHPSIVVTYTRRGVLQKEVIAHPT | |
PSQ01942 | FD00086 | Arabinogalactan protein 41 | Q8L9T8 | Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis | Arabidopsis thaliana (Mouse-ear cress) | 25 | None | 63 | Arabinogalactan peptide 41 | AGP41 | 3702 | anchored component of membrane, plasma membrane | None | 15322080 | 25 | 39:63 | DGTTIDQGIAYVLMLVALVLTYLIH | |
PSQ01943 | FND00287 | Arabinogalactan protein 40 | Q8LD43 | Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis | Arabidopsis thaliana (Mouse-ear cress) | 27 | None | 62 | Arabinogalactan peptide 40 | AGP40 | 3702 | anchored component of membrane, plasma membrane | None | 15322080 | 27 | 36:62 | SASTVAFPVVGSIVAASLSAFLALLLQ | |
PSQ01944 | FD00054 | Endonuclease 3 | Q8LDW6 | Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis | Arabidopsis thaliana (Mouse-ear cress) | 16 | endonuclease activity, endoribonuclease activity, metal ion binding, nucleic acid binding, single-stranded DNA endodeoxyribonuclease activity | 300 | Deoxyribonuclease ENDO3 , Single-stranded-nucleate endonuclease ENDO3 | ENDO3 | 3702 | None | DNA catabolic process, RNA phosphodiester bond hydrolysis, endonucleolytic | 23620482 | 16 | 279:294 | GTLNRIFSAKRKLARA | |
PSQ01945 | FD00379 | Long chain acyl-CoA synthetase 6 | Q8LPS1 | Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis | Arabidopsis thaliana (Mouse-ear cress) | 38 | ATP binding, long-chain fatty acid-CoA ligase activity | 701 | None | LACS6 | 3702 | cytosol, endoplasmic reticulum, glyoxysomal membrane, membrane, peroxisome | fatty acid metabolic process, multicellular organism development, response to ozone | 12481085 | 38 | 1:38 | MDSSSSSSSAAARRRINAIHSHLVTSSRSSPLLRSNPT | |
PSQ01957 | FND00264 | Arabinogalactan protein 23 | Q8S2W4 | Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis | Arabidopsis thaliana (Mouse-ear cress) | 26 | None | 61 | Arabinogalactan peptide 23 | AGP23 | 3702 | anchored component of membrane, plasma membrane | None | 15322080 | 26 | 36:61 | AASAALPALGSLVGASLVSLFSYYLH | |
PSQ01962 | FD00221 | Bowman-Birk type proteinase inhibitor | Q8W4Y8 | Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids fabids Fabales Fabaceae Papilionoideae 50 kb inversion clade NPAAA clade Hologalegina IRL clade Fabeae Lens | Lens culinaris (Lentil) (Cicer lens) | 14 | serine-type endopeptidase inhibitor activity | 110 | LCTI, Trypsin | None | 3864 | extracellular region | None | 15212472, 16889634 | 14 | 29:42 | RFDSTSFITQVLSN | |
PSQ01983 | FND00048 | Hydroxyproline-rich systemin B | Q93WP7 | Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae asterids lamiids Solanales Solanaceae Nicotianoideae Nicotianeae Nicotiana | Nicotiana tabacum (Common tobacco) | 17, 89 | hormone activity | 164 | None | None | 4097 | extracellular region | defense response | 11459063;11459063 | 106 | 19:35, 54:142 | RTLLENHEGLNVGSGYG, VSNSVSPTRTDEKTSENTELVMTTIAQGENSNQLFPFLTSSDNYQLASFKKLSISYLLPVSYVWKLISSSSFNHDLVDIFDTSSDEKYW | |
PSQ01984 | FND00048 | Hydroxyproline-rich systemin A | Q93WP8 | Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae asterids lamiids Solanales Solanaceae Nicotianoideae Nicotianeae Nicotiana | Nicotiana tabacum (Common tobacco) | 17, 90 | hormone activity | 165 | None | None | 4097 | extracellular region | defense response | 11459063;11459063 | 107 | 19:35, 54:143 | RTLLENHEGLNVGSGYG, VSNSVSPTRTDEKTSENTELVMTTIAQGENINQLFSFPTSADNYYQLASFKKLFISYLLPVSYVWNLIGSSSFDHDLVDIFDSKSDERYW | |
PSQ01985 | FD00385 | Snakin-2 | Q93X17 | Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae asterids lamiids Solanales Solanaceae Solanoideae Solaneae Solanum | Solanum tuberosum (Potato) | 15 | None | 104 | None | SN2 | 4113 | cell wall, extracellular region | defense response | 11891250 | 15 | 24:38 | IQTDQVTSNAISEAA | |
PSQ01986 | FD00381 | Stachyose synthase | Q93XK2 | Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids fabids Fabales Fabaceae Papilionoideae 50 kb inversion clade NPAAA clade Hologalegina IRL clade Fabeae Pisum | Pisum sativum (Garden pea) | 11 | galactinol-raffinose galactosyltransferase activity | 853 | Galactinol--raffinose galactosyltransferase | STS1 | 3888 | cytoplasm | oligosaccharide biosynthetic process, stachyose biosynthetic process | 11675396 | 11 | 1:11 | MAPPLNSTTSN | |
PSQ01987 | FD00366 | Rapid alkalinization factor | Q945T0 | Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae asterids lamiids Solanales Solanaceae Nicotianoideae Nicotianeae Nicotiana | Nicotiana tabacum (Common tobacco) | 43 | hormone activity, receptor ligand activity | 120 | None | RALF | 4097 | extracellular region, plasmodesma | calcium-mediated signaling, regulation of signaling receptor activity | 11675511 | 43 | 24:66 | GDSGAYDWVMPARSGGGCKGSIGECIAEEEEFELDSESNRRIL | |
PSQ01989 | FD00082 | Cathepsin B-like protease 3 | Q94K85 | Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis | Arabidopsis thaliana (Mouse-ear cress) | 76, 17 | cysteine-type endopeptidase activity | 360 | Cathepsin B3 | CATHB3 | 3702 | cytosol, extracellular space, lysosome, secretory vesicle, vacuole | defense response, proteolysis involved in cellular protein catabolic process, regulation of catalytic activity | 27058316;27058316 | 93 | 27:102, 343:359 | GIEAESLTKQKLDSKILQDEIVKKVNENPNAGWKAAINDRFSNATVAEFKRLLGVKPTPKKHFLGVPIVSHDPSLK, NVFRVDTGSNDLPVASV | |
PSQ02004 | FD00310 | Lectin-B | Q9AVB0 | Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae Caryophyllales Phytolaccaceae Phytolacca | Phytolacca americana (American pokeweed) (Phytolacca decandra) | 15, 25 | carbohydrate binding, chitin binding | 361 | PL-B | None | 3527 | None | positive regulation of cell division, positive regulation of mitotic nuclear division | 9145528;9145528 | 40 | 27:41, 337:361 | HEGHGVVELIMGKLG, SLPSPLSQILAIRKLNATIPTMAVE | |
PSQ02005 | FD00318 | Lectin-C | Q9AYP9 | Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae Caryophyllales Phytolaccaceae Phytolacca | Phytolacca americana (American pokeweed) (Phytolacca decandra) | 18, 24 | carbohydrate binding, chitin binding | 194 | PL-C | None | 3527 | None | positive regulation of cell division, positive regulation of mitotic nuclear division | 7670205;7670205 | 42 | 27:44, 171:194 | QGHEGHGVGEILLMGKLG, LLPSPLRRIIAIRKLKANLANMLS | |
PSQ02013 | FND00047 | Arabinogalactan protein 21 | Q9C8A4 | Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis | Arabidopsis thaliana (Mouse-ear cress) | 22 | None | 60 | Arabinogalactan peptide 21 | AGP21 | 3702 | anchored component of membrane, plasma membrane | None | 15322080 | 22 | 37:58 | DAAMFVPALFASVVALASGFIF | |
PSQ02014 | FD00054 | Endonuclease 2 | Q9C9G4 | Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis | Arabidopsis thaliana (Mouse-ear cress) | 8 | double-stranded DNA exodeoxyribonuclease activity, endonuclease activity, endoribonuclease activity, metal ion binding, nucleic acid binding, single-stranded DNA endodeoxyribonuclease activity, T/G mismatch-specific endonuclease activity | 290 | Deoxyribonuclease ENDO2 , Single-stranded-nucleate endonuclease ENDO2 | ENDO2 | 3702 | None | DNA catabolic process, RNA phosphodiester bond hydrolysis, endonucleolytic | 23620482 | 8 | 283:290 | ATLNRIFG | |
PSQ02023 | FD00028 | 2S seed storage protein 5 | Q9FH31 | Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis | Arabidopsis thaliana (Mouse-ear cress) | 19 | nutrient reservoir activity | 165 | Seed storage albumin 5 | SESA5 | 3702 | None | pollen development | 8310078 | 19 | 71:89 | YEADDFELTLDVDLEDDEN |