Home Advance Search BLAST Contact Documentation/Help Feedback
Family
Protein Name
Uniprot ID
Taxonomy
Organism
Prosequence length
Functions
PreProtein length
Alt Name
Gene Name
NCBI ID
Cell Org
Process
PubMed
Total Proseq length
Proseq Loc
Prosequence Sequence

Proseq ID Family Protein Name Uniprot ID Taxonomy Organism Prosequence length Functions PreProtein length Alter Name Gene Name NCBI ID Cell Org Process PubMed Total Proseq length Proseq Loc Prosequence Sequence
PSQ02024 FD00086 Arabinogalactan protein 22 Q9FK16 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) 25 None 63 Arabinogalactan peptide 22 AGP22 3702 anchored component of membrane, plasma membrane None 15322080 25 39:63 DGTSIDQGIAYVLMMVALALTYFIH
PSQ02025 FD00160 Sucrose Q9FSV7 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida Liliopsida Poales Poaceae BOP clade Pooideae Poodae Poeae Poeae Chloroplast Group 2 (Poeae type) Loliinae Lolium Festuca arundinacea (Tall fescue) (Schedonorus arundinaceus) 106 sucrose 1F-fructosyltransferase activity, sucrose alpha-glucosidase activity 660 Sucrose 1(F)-fructosyltransferase, Sucrose 1-SST 4606 vacuole carbohydrate metabolic process 11080298 106 1:106 MESSAVVPGTTAPLLPYAYAPLPSSADDARENQSSGGVRWRVCAAVLAASALAVLIVVGLLAGGRVDRGPAGGDVASAAVPAVPMEIPRSRGKDFGVSEKASGAYS
PSQ02026 FD00174 Polygalacturonase Q9FY19 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Pinopsida Pinidae Cupressales Cupressaceae Juniperus Juniperus ashei (Ozark white cedar) 34 polygalacturonase activity 507 Major pollen allergen Jun a 2, Pectinase JNA2 13101 cell wall, extracellular region carbohydrate metabolic process, cell wall organization, fruit ripening 10944464 34 21:54 AGEDQSAQIMLDSDTKQYHRSSRNLRKRVHHARH
PSQ02037 FND00047 Arabinogalactan protein 12 Q9LJD9 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) 22 None 60 Arabinogalactan peptide 12 AGP12 3702 anchored component of membrane, plasma membrane None 11006345, 15322080 22 39:60 DAAMFVPALFASVAALASGFLF
PSQ02038 FD00296 Rapid alkalinization factor 23 Q9LUS7 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) 60 hormone activity 138 Protein RALF-like 23 RALF23 3702 apoplast, plasmodesma brassinosteroid mediated signaling pathway, calcium-mediated signaling, cell-cell signaling, negative regulation of growth, response to brassinosteroid 19473327 60 29:88 VSSQSTEFAGDFPPFETECRGTIAECSVSAALGDGGDLFYGGGEMGEEFEMDSEINRRIL
PSQ02039 FD00262 Elicitor peptide 1 Q9LV87 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) 69 None 92 None PEP1 3702 None innate immune response, response to ethylene, response to jasmonic acid, response to wounding 16785434 69 1:69 MEKSDRRSEESHLWIPLQCLDQTLRAILKCLGLFHQDSPTTSSPGTSKQPKEEKEDVTMEKEEVVVTSR
PSQ02040 FND00061 Arabinogalactan protein 14 Q9LVC0 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) 22 None 60 Arabinogalactan peptide 14 AGP14 3702 anchored component of membrane, plasma membrane root hair elongation 11006345, 15322080 22 39:60 DASSFIPTFFASVAVMAFGFFF
PSQ02041 FND00334 Arabinogalactan protein 15 Q9LYF6 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) 26 None 61 Arabinogalactan peptide 15 AGP15 3702 anchored component of membrane, plasma membrane None 11006345, 15322080 26 36:61 SAISASFVSAGVAAVAALVFGSALRI
PSQ02042 FD00086 Arabinogalactan protein 20 Q9M373 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) 37 None 74 Arabinogalactan peptide 20 AGP20 3702 anchored component of membrane, plasma membrane None 15322080 37 38:74 DGTSIDQGIAYLLMVVALVLTYLIHPLDASSSSYTFF
PSQ02043 FD00056 Subtilisin-like protease SBT3 Q9MAP5 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) 87 serine-type endopeptidase activity 780 Subtilase subfamily 3 member 3 SBT3 3702 extracellular matrix, extracellular space, plant-type cell wall induced systemic resistance 23818851 87 25:111 RSETESKVHIVYLGEKKHHDPEFVTESHHQMLASLLGSKKDADDSMVYSYRHGFSGFAAKLTKSQAKKIADLPEVVHVIPDGFHELA
PSQ02044 FD00056 Subtilisin-like protease SBT3 Q9MAP7 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) 85 serine-type endopeptidase activity 780 Subtilase subfamily 3 member 5 SBT3 3702 cell wall, extracellular space regulation of growth 24665109 85 24:108 SDESKVHIVYLGEKQHDDPEFVSESHHQMLSSLLGSKVDAHESMVYSYRHGFSGFAAKLTESQAKKLADSPEVVHVMADSFYELA
PSQ02065 FD00361 Polyneuridine-aldehyde esterase Q9SE93 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae asterids lamiids Gentianales Apocynaceae Rauvolfioideae Vinceae Rauvolfiinae Rauvolfia Rauvolfia serpentina (Serpentine wood) (Ophioxylon serpentinum) 6 polyneuridine-aldehyde esterase activity 264 Polyneuridine aldehyde esterase PNAE 4060 None indole alkaloid metabolic process 10691977 6 1:6 MHSAAN
PSQ02066 FND00061 Arabinogalactan protein 13 Q9STQ3 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) 22 None 60 Arabinogalactan peptide 13 AGP13 3702 anchored component of membrane, plasma membrane None 11006345, 15322080 22 38:59 DASLAIPAFFASVATLAFGFLF
PSQ02067 FD00054 Endonuclease 1 Q9SXA6 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) 19 double-stranded DNA exodeoxyribonuclease activity, endonuclease activity, endoribonuclease activity, endoribonuclease activity, producing 5, metal ion binding, nucleic acid binding, single-stranded DNA endodeoxyribonuclease activity, T/G mismatch-specific endonuclease activity 305 Bifunctional nuclease I , Deoxyribonuclease ENDO1 , Single-stranded-nucleate endonuclease ENDO1 ENDO1 3702 None DNA catabolic process, floral organ senescence, leaf senescence, RNA phosphodiester bond hydrolysis, endonucleolytic 23620482 19 287:305 MILNRVFSDDHAIAGVAAT
PSQ02091 FD00412 Procardosin-A Q9XFX3 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae asterids campanulids Asterales Asteraceae Carduoideae Cardueae Carduinae Cynara Cynara cardunculus (Cardoon) 44, 105 aspartic-type endopeptidase activity 504 None cardA 4265 cell wall, endoplasmic reticulum, extracellular region, membrane, protein storage vacuole lipid metabolic process 9692911;9692911 149 25:68, 310:414 VSDDGLIRIGLKKRKVDRIDQLRGRRALMEGNARKDFGFRGTVR, GVMNQQCKTVVSRYGRDIIEMLRSKIQPDKICSHMKLCTFDGARDVSSIIESVVDKNNDKSSGGIHDEMCTFCEMAVVWMQNEIKQSETEDNIINYANELCEHLS
PSQ02092 FD00487 Procardosin-B Q9XFX4 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae asterids campanulids Asterales Asteraceae Carduoideae Cardueae Carduinae Cynara Cynara cardunculus (Cardoon) 46 aspartic-type endopeptidase activity 506 None cardB 4265 cell wall, endoplasmic reticulum, extracellular region, membrane, protein storage vacuole lipid metabolic process 8654427 46 25:70 VSNGGLLRVGLKKRKVDRLDQLRAHGVHMLGNARKDFGFRRTLSDS
PSQ02131 FD00083 Cysteine protease Amb a 11 V5LU01 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae asterids campanulids Asterales Asteraceae Asteroideae Heliantheae alliance Heliantheae Ambrosia Ambrosia artemisiifolia (Short ragweed) 86, 16 cysteine-type endopeptidase activity, protein homodimerization activity 386 Amino acid thiol protease , Pollen allergen Amb a 11 None 4212 None None 25865353;25865353 102 23:108, 371:386 FHYHERELESEEGFMGMYDRWREQHNIEMRSPERFNVFKYNVRRIHESNKMDKPYKLKVNEFADMTNLEFVNTYANSKISHFQALR, KTTQRLQGIRTKLLEL
Go to Lab Web Page