Home Advance Search BLAST Contact Documentation/Help Feedback
Family
Protein Name
Uniprot ID
Taxonomy
Organism
Prosequence length
Functions
PreProtein length
Alt Name
Gene Name
NCBI ID
Cell Org
Process
PubMed
Total Proseq length
Proseq Loc
Prosequence Sequence

Proseq ID Family Protein Name Uniprot ID Taxonomy Organism Prosequence length Functions PreProtein length Alter Name Gene Name NCBI ID Cell Org Process PubMed Total Proseq length Proseq Loc Prosequence Sequence
PSQ01572 FD00028 2S albumin seed storage protein P93198 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids fabids Fagales Juglandaceae Juglans Juglans regia (English walnut) 16, 14 nutrient reservoir activity 139 2S albumin , Allergen Jug r 1 None 51240 extraorganismal space seed maturation 11799381;11799381 30 16:31, 58:71 FRTTITTMEIDEDIDN, QQSRSGGYDEDNQR
PSQ01590 FD00215 Alliin lyase 1 Q01594 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida Liliopsida Asparagales Amaryllidaceae Allioideae Allieae Allium Allium sativum (Garlic) 10 alliin lyase activity, chloride ion binding, protein homodimerization activity, pyridoxal phosphate binding 486 Cysteine sulphoxide lyase 1 None 4682 vacuole None 1385120 10 29:38 LVNNNNMVQA
PSQ01630 FD00221 Bowman-Birk type bran trypsin inhibitor Q0JR25 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida Liliopsida Poales Poaceae BOP clade Oryzoideae Oryzeae Oryzinae Oryza Oryza sativa Oryza sativa subsp 96 serine-type endopeptidase inhibitor activity 254 OSE727A, Protein RBBI3-3, RBTI RBBI3 39947 extracellular region None 3667571 96 23:118 HGDGDTTIRLPSDGAKASRPRAAKPWDCCDNIEISRLMIYPPLYRCNDEVKQCAAACKECVEAPGGDFNGGAFVCSDWFSTVDPGPKCTAALDGLS
PSQ01642 FD00362 Subtilisin-like protease SBT6 Q0WUG6 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) 151 endopeptidase activity, serine-type endopeptidase activity 1038 Site-1 protease , Subtilase subfamily 6 member 1 SBT6 3702 Golgi apparatus, Golgi membrane, integral component of membrane hyperosmotic response, hyperosmotic salinity response, proteolysis 17662035 151 31:181 STYHPQQQNLNPENVTRLESENETKTNYIIRFKQYKPAKDHRIYLESKVRSGGWGWIERINPATKYPTDFGVLWIEESGKEAVVGEIERLEMVKDVNVEFKYQRVLLGGSFPDGKKRPGKIFTSMSFEEGTESSPMADTSNTTLNWSRHLL
PSQ01678 FD00149 Photosystem II protein D1 Q1KVU8 Eukaryota Viridiplantae Chlorophyta core chlorophytes Chlorophyceae Sphaeropleales Scenedesmaceae Tetradesmus Tetradesmus obliquus (Green alga) (Acutodesmus obliquus) 9 chlorophyll binding, electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity, iron ion binding, oxidoreductase activity, acting on diphenols and related substances as donors, oxygen as acceptor, oxygen evolving activity 360 Photosystem II Q(B) protein psbA 3088 chloroplast thylakoid membrane, integral component of membrane, photosystem II photosynthetic electron transport in photosystem II, protein-chromophore linkage, response to herbicide 9252339 9 345:353 SVEAPSVNA
PSQ01712 FND00246 Violacin-A Q2HY54 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids fabids Malpighiales Violaceae Viola Viola odorata (Sweet violet) 50 None 106 Violacin-1 None 97441 None defense response, hemolysis in other organism 16488428, 16872274 50 30:79 VDDFITRRAYDNLVKSGAIKDIPVMAKTIISNPVLEEGMLTYYTNKKLGD
PSQ01731 FD00028 2S albumin Q39649 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids fabids Cucurbitales Cucurbitaceae Cucurbiteae Cucurbita Cucurbita maxima (Pumpkin) (Winter squash) 13 nutrient reservoir activity 141 None None 3661 aleurone grain, storage vacuole None 1743299, 8275099 13 23:35 YRTTITTVEVEEN
PSQ01738 FND00351 Protein GOLVEN 11 Q3E880 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) 83 growth factor activity 120 CLAVATA3, Root meristem growth factor 1 GLV11 3702 extracellular space cell differentiation, cellular response to phosphate starvation, maintenance of root meristem identity, positive regulation of cell population proliferation, positive regulation of gene expression, posttranscriptional regulation of gene expression, regulation of asymmetric cell division, regulation of cell division, regulation of lateral root development, regulation of reactive oxygen species metabolic process, regulation of root development, regulation of root meristem growth, regulation of root morphogenesis 20798316 83 21:103 KVSNANFNSQAPQMKNSEGLGASNGTQIAKKHAEDVIENRKTLKHVNVKVEANEKNGLEIESKEMVKKRKNKKRLTKTESLTA
PSQ01743 FD00468 Polygalacturonase-1 non-catalytic subunit beta Q40161 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae asterids lamiids Solanales Solanaceae Solanoideae Solaneae Solanum Solanum subgen Lycopersicon Solanum lycopersicum (Tomato) (Lycopersicon esculentum) 81 None 630 AroGP1, Polygalacturonase converter GP1 4081 apoplast, cell wall cell wall organization, fruit ripening 1392611 81 28:108 GDGESGNPFTPKGYLIRYWKKQISNDLPKPWFLLNKASPLNAAQYATYTKLVADQNALTTQLHTFCSSANLMCAPDLSPSL
PSQ01744 FD00045 Nodule lectin Q40987 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids fabids Fabales Fabaceae Papilionoideae 50 kb inversion clade NPAAA clade Hologalegina IRL clade Fabeae Pisum Pisum sativum (Garden pea) 8 carbohydrate binding 270 PsNlec-1 NLEC1 3888 peribacteroid fluid, peribacteroid membrane biological process involved in symbiotic interaction 8685275 8 34:41 LSFNFTKL
PSQ01748 FND00199 Trypsin inhibitor 1 Q4GWU5 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae asterids campanulids Asterales Asteraceae Asteroideae Heliantheae alliance Heliantheae Helianthus Helianthus annuus (Common sunflower) 14 endopeptidase inhibitor activity, protease binding, serine-type endopeptidase inhibitor activity 60 SFTI-1 sfti1 4232 None negative regulation of endopeptidase activity 10390350 14 26:39 GYKTSISTITIEDN
PSQ01762 FD00112 Conglutin beta 1 Q53HY0 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids fabids Fabales Fabaceae Papilionoideae 50 kb inversion clade genistoids sensu lato core genistoids Genisteae Lupinus Lupinus albus (White lupine) (Lupinus termis) 78 nutrient reservoir activity 538 Protein Lup-1 None 3870 None None 9299789 78 31:108 EKDVLKSHERPEEREQEEWQPRRQRPQSRREEREQEQEQGSPSYPRRQSGYERRQYHERSEQREEREQEQQQGSPSYS
PSQ01805 FD00097 Antimicrobial peptide Ar-AMP Q5I2B2 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae Caryophyllales Amaranthaceae Amaranthus Amaranthus retroflexus (Redroot amaranth) (American pigweed) 34 chitin binding 89 None None 124763 None defense response to fungus, defense response to Gram-positive bacterium, killing of cells of other organism 16126239 34 56:89 ASTTVDHQADAAAAAATKTANNPTDAKLAGAGSP
PSQ01808 FND00123 Arabinogalactan protein 24 Q5PP12 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) 27 None 69 Arabinogalactan peptide 24 AGP24 3702 anchored component of membrane, plasma membrane None 15322080 27 43:69 SSTVVSATNMFTVLAIAAVALVVGSNH
PSQ01813 FND00305 Varv peptide A Q5USN7 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids fabids Malpighiales Violaceae Viola Viola odorata (Sweet violet) 46, 25, 25 None 207 Cyclotide k1 Vok1 97441 None defense response, hemolysis in other organism 16872274;16872274;16872274 96 21:66, 96:120, 150:174 TEQDVITLQAYEELLKNGAANGMTKTVISSPVLEEALVSYSKNKLG, SLESTKSANPLLEEALTAFAKKGLG, ALETQKPNHLLEEALVAFAKKGNLG
PSQ01814 FD00034 Cycloviolacin-O13 Q5USN8 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids fabids Malpighiales Violaceae Viola Viola odorata (Sweet violet) 59 None 120 Cyclotide c3 Voc3 97441 None defense response, hemolysis in other organism 16872274 59 23:81 TFEKDFITPETIQAILKKSAPLSNIMLEEDVINALLKSKTVISNPIIEEAFLKNSNGLN
PSQ01844 FD00112 Conglutin beta 2 Q6EBC1 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids fabids Fabales Fabaceae Papilionoideae 50 kb inversion clade genistoids sensu lato core genistoids Genisteae Lupinus Lupinus albus (White lupine) (Lupinus termis) 78 nutrient reservoir activity 540 None None 3870 None None 20066045, 9299789 78 31:108 EKDVLKSHERPEEREQEEWQPRRQRPQSRREEREQEQEQGSPSYPRRQSGYERRQYHERSEQREEREQEQQQGSPSYS
PSQ01845 FD00364 Heterotepalin-4 Q6EH50 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae Caryophyllales Phytolaccaceae Phytolacca Phytolacca heterotepala (Mexican pokeweed) 29 hydrolase activity, rRNA N-glycosylase activity, toxin activity 312 Ribosome-inactivating protein , rRNA N-glycosidase RIP1 248308 None defense response, negative regulation of translation 17258249 29 284:312 YNQNAMFPQLIMSTYYNYMANLGDLFEEF
PSQ01862 FND00097 Lectin Q6T6H8 Eukaryota Viridiplantae Chlorophyta Ulvophyceae OUU clade Ulvales Ulvaceae Ulva Ulva pertusa (Sea lettuce) 33 carbohydrate binding 203 None UPL1 3120 None None 14970906 33 21:53 RQVGVGADVLHAVENTIDSITGVEASHSALEVG
PSQ01870 FD00235 Volkensin Q70US9 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids fabids Malpighiales Passifloraceae Adenia Adenia volkensii (Kilyambiti plant) 15 carbohydrate binding, rRNA N-glycosylase activity, toxin activity 523 None volk38 219186 None defense response, metabolic process, negative regulation of translation 14686924 15 251:265 QSDSPLVIRSFVDRN