Home Advance Search BLAST Contact Documentation/Help Feedback

Details of PSQ00278

ProSeqID PSQ00278
Family FND00089
Protein Name Tau-AnmTx Ueq 12-1
UniProt ID C0HK26
Taxonomy Eukaryota-Metazoa-Cnidaria-Anthozoa-Hexacorallia-Actiniaria-Actiniidae-Urticina
Organisms Urticina eques (Sea anemone)
Prosequence Length (aa) 9
Functions toxin activity
Preproprotein Length (aa) 74
Alt Name None
Gene Name None
NCBI ID 417072
Cellular Localization extracellular region
Processes defense response to bacterium
PubMed 28468269
Total Prosequence Length (aa) 9
Prosequence Location 19:27
Prosequence Sequence AGFGKRTLK
Preproprotein Sequence MCLLMLVLGAMYVQGWHSAGFGKRTLKKRCYPGQPGCGHCSRPNYCEGARCESGFHDCGSDHWCDASGDRCCCA