Home Advance Search BLAST Contact Documentation/Help Feedback

Details of PSQ02107

ProSeqID PSQ02107
Family FD00415
Protein Name Apoptosis-inducing factor 1
UniProt ID Q9Z0X1
Taxonomy Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Mammalia-Eutheria-Euarchontoglires-Glires-Rodentia-Myomorpha-Muroidea-Muridae-Murinae-Mus-Mus
Organisms Mus musculus (Mouse)
Prosequence Length (aa) 47
Functions DNA binding, electron-transferring-flavoprotein dehydrogenase activity, FAD binding, NAD(P)H oxidase H2O2-forming activity, NADH dehydrogenase activity, oxidoreductase activity, acting on NAD(P)H, protein dimerization activity
Preproprotein Length (aa) 612
Alt Name Programmed cell death protein 8
Gene Name Aifm1
NCBI ID 10090
Cellular Localization cytoplasm, cytosol, mitochondrial inner membrane, mitochondrial intermembrane space, mitochondrial outer membrane, mitochondrion, nucleus, perinuclear region of cytoplasm
Processes activation of cysteine-type endopeptidase activity involved in apoptotic process, apoptotic mitochondrial changes, apoptotic process, cellular response to aldosterone, cellular response to estradiol stimulus, cellular response to hydrogen peroxide, cellular response to nitric oxide, cellular response to oxygen-glucose deprivation, intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress, mitochondrial respiratory chain complex assembly, mitochondrial respiratory chain complex I assembly, neuron apoptotic process, neuron differentiation, positive regulation of apoptotic process, positive regulation of cell death, positive regulation of neuron apoptotic process, protein import into mitochondrial intermembrane space, regulation of apoptotic DNA fragmentation, response to ischemia, response to L-glutamate, response to oxidative stress, response to toxic substance
PubMed 9989411
Total Prosequence Length (aa) 47
Prosequence Location 55:101
Prosequence Sequence SSGSSGGKMDNSVLVLIVGLSTIGAGAYAYKTIKEDQKRYNERVMGL
Preproprotein Sequence MFRCGGLAGAFKQKLVPLVRTVYVQRPKQRNRLPGNLFQQWRVPLELQMARQMASSGSSGGKMDNSVLVLIVGLSTIGAGAYAYKTIKEDQKRYNERVMGLGLSPEEKQRRAIASATEGGSVPQIRAPSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLQFRQWNGKERSIYFQPPSFYVSAQDLPNIENGGVAVLTGKKVVHLDVRGNMVKLNDGSQITFEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRALEKISREVKSITVIGGGFLGSELACALGRKSQASGIEVIQLFPEKGNMGKILPQYLSNWTMEKVKREGVKVMPNAIVQSVGVSGGRLLIKLKDGRKVETDHIVTAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPPSAPAVPQVPVEGEDYGKGVIFYLRDKVVVGIVLWNVFNRMPIARKIIKDGEQHEDLNEVAKLFNIHED