Home Advance Search BLAST Contact Documentation/Help Feedback

Details of PSQ02106

ProSeqID PSQ02106
Family FD00088
Protein Name Proepiregulin
UniProt ID Q9Z0L5
Taxonomy Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Mammalia-Eutheria-Euarchontoglires-Glires-Rodentia-Myomorpha-Muroidea-Muridae-Murinae-Rattus
Organisms Rattus norvegicus (Rat)
Prosequence Length (aa) 33
Functions epidermal growth factor receptor binding, growth factor activity
Preproprotein Length (aa) 162
Alt Name None
Gene Name Ereg
NCBI ID 10116
Cellular Localization extracellular space, integral component of membrane, plasma membrane
Processes angiogenesis, cell population proliferation, cell-cell signaling, cytokine-mediated signaling pathway, epidermal growth factor receptor signaling pathway, female meiotic nuclear division, keratinocyte proliferation, luteinizing hormone signaling pathway, mRNA transcription, negative regulation of cell population proliferation, negative regulation of smooth muscle cell differentiation, negative regulation of transcription, DNA-templated, oocyte maturation, ovarian cumulus expansion, ovulation, positive regulation of angiogenesis, positive regulation of cell division, positive regulation of cell population proliferation, positive regulation of cytokine production, positive regulation of DNA replication, positive regulation of epidermal growth factor-activated receptor activity, positive regulation of fibroblast proliferation, positive regulation of innate immune response, positive regulation of interleukin-6 production, positive regulation of mitotic nuclear division, positive regulation of phosphorylation, positive regulation of protein kinase activity, positive regulation of smooth muscle cell proliferation, primary follicle stage, response to peptide hormone
PubMed 9990076
Total Prosequence Length (aa) 33
Prosequence Location 23:55
Prosequence Sequence VISTTVIPSCIPEESEDNCTALVQMEDDPRVAQ
Preproprotein Sequence METFPAAWVLALLCLGSHLLQAVISTTVIPSCIPEESEDNCTALVQMEDDPRVAQVLITKCSSDMDGYCLHGHCIYLVDMSEKYCRCEVGYTGLRCEHFFLTVHQPLSREYVALTVILVFLFLIVTAGSMYYFCRWYRNRKSKKSREEYERVTSGGPGLPQV