Details of PSQ00105
| ProSeqID |
PSQ00105 |
| Family |
FND00022 |
| Protein Name |
Medusin-AS |
| UniProt ID |
A0A5Q0MU22
|
| Taxonomy |
Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Amphibia-Batrachia-Anura-Neobatrachia-Hyloidea-Hylidae-Phyllomedusinae-Agalychnis |
| Organisms |
Agalychnis spurrelli (Gliding leaf frog) (Agalychnis litodryas) |
| Prosequence Length (aa) |
27 |
| Functions |
None |
| Preproprotein Length (aa) |
68 |
| Alt Name |
None |
| Gene Name |
None |
| NCBI ID |
317303 |
| Cellular Localization |
extracellular region |
| Processes |
defense response to bacterium, defense response to fungus, innate immune response, killing of cells of other organism |
| PubMed |
31671555
|
| Total Prosequence Length (aa) |
27 |
| Prosequence Location |
23:49 |
| Prosequence Sequence |
EEEKRESEEEKNEQEEDDRDERSEEKR |
| Preproprotein Sequence |
MAFLKKSLFLVLFLGLVSLSVCEEEKRESEEEKNEQEEDDRDERSEEKRLLGMIPLAISAISALSKLG |