Home Advance Search BLAST Contact Documentation/Help Feedback

Details of PSQ01748

ProSeqID PSQ01748
Family FND00199
Protein Name Trypsin inhibitor 1
UniProt ID Q4GWU5
Taxonomy Eukaryota-Viridiplantae-Streptophyta-Embryophyta-Tracheophyta-Spermatophyta-Magnoliopsida-Eudicotyledons-Gunneridae-Pentapetalae-Asterids-Campanulids-Asterales-Asteraceae-Asteroideae-Heliantheae-Alliance-Heliantheae-Helianthus
Organisms Helianthus annuus (Common sunflower)
Prosequence Length (aa) 14
Functions endopeptidase inhibitor activity, protease binding, serine-type endopeptidase inhibitor activity
Preproprotein Length (aa) 60
Alt Name SFTI-1
Gene Name sfti1
NCBI ID 4232
Cellular Localization None
Processes negative regulation of endopeptidase activity
PubMed 10390350
Total Prosequence Length (aa) 14
Prosequence Location 26:39
Prosequence Sequence GYKTSISTITIEDN
Preproprotein Sequence MATTMAKLITLVVLAILAFVEVSVSGYKTSISTITIEDNGRCTKSIPPICFPDGRP