Details of PSQ01738
| ProSeqID |
PSQ01738 |
| Family |
FND00351 |
| Protein Name |
Protein GOLVEN 11 |
| UniProt ID |
Q3E880
|
| Taxonomy |
Eukaryota-Viridiplantae-Streptophyta-Embryophyta-Tracheophyta-Spermatophyta-Magnoliopsida-Eudicotyledons-Gunneridae-Pentapetalae-Rosids-Malvids-Brassicales-Brassicaceae-Camelineae-Arabidopsis |
| Organisms |
Arabidopsis thaliana (Mouse-ear cress) |
| Prosequence Length (aa) |
83 |
| Functions |
growth factor activity |
| Preproprotein Length (aa) |
120 |
| Alt Name |
CLAVATA3, Root meristem growth factor 1 |
| Gene Name |
GLV11 |
| NCBI ID |
3702 |
| Cellular Localization |
extracellular space |
| Processes |
cell differentiation, cellular response to phosphate starvation, maintenance of root meristem identity, positive regulation of cell population proliferation, positive regulation of gene expression, posttranscriptional regulation of gene expression, regulation of asymmetric cell division, regulation of cell division, regulation of lateral root development, regulation of reactive oxygen species metabolic process, regulation of root development, regulation of root meristem growth, regulation of root morphogenesis |
| PubMed |
20798316
|
| Total Prosequence Length (aa) |
83 |
| Prosequence Location |
21:103 |
| Prosequence Sequence |
KVSNANFNSQAPQMKNSEGLGASNGTQIAKKHAEDVIENRKTLKHVNVKVEANEKNGLEIESKEMVKKRKNKKRLTKTESLTA |
| Preproprotein Sequence |
MVSIRVICYLLVFSVLQVHAKVSNANFNSQAPQMKNSEGLGASNGTQIAKKHAEDVIENRKTLKHVNVKVEANEKNGLEIESKEMVKKRKNKKRLTKTESLTADYSNPGHHPPRHN |
