Home Advance Search BLAST Contact Documentation/Help Feedback
Family
Protein Name
Uniprot ID
Taxonomy
Organism
Prosequence length
Functions
PreProtein length
Alt Name
Gene Name
NCBI ID
Cell Org
Process
PubMed
Total Proseq length
Proseq Loc
Prosequence Sequence

Proseq ID Family Protein Name Uniprot ID Taxonomy Organism Prosequence length Functions PreProtein length Alter Name Gene Name NCBI ID Cell Org Process PubMed Total Proseq length Proseq Loc Prosequence Sequence
PSQ00223 FND00012 Drosulfakinins B2ZB95 Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Diptera Brachycera Muscomorpha Ephydroidea Drosophilidae Drosophila Sophophora Drosophila erecta (Fruit fly) 42, 26 neuropeptide hormone activity, neuropeptide receptor binding 141 None Dsk 7220 extracellular region adult feeding behavior, adult locomotory behavior, larval locomotory behavior, multicellular organismal response to stress, neuromuscular junction development, neuropeptide signaling pathway, positive regulation of cytosolic calcium ion concentration, regulation of smooth muscle contraction, smooth muscle contraction 17632121;17632121 68 32:73, 86:111 QTTSLQISKEDRRLQELESKMGAESEQPNANLVGPSISRFGD, VPLISRPMIPIELDLLMDNDDERTKA
PSQ00224 FND00012 Drosulfakinins B2ZB96 Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Diptera Brachycera Muscomorpha Ephydroidea Drosophilidae Drosophila Sophophora Drosophila mauritiana (Fruit fly) 40, 26 hormone activity 141 None Dsk 7226 extracellular region neuropeptide signaling pathway, smooth muscle contraction 17632121;17632121 66 34:73, 86:111 TSLQNAKDDRRLQELESKIGAESDQPNANLVGPSFSRFGD, VPLISRPMIPIELDLLMDNDDERTKA
PSQ00225 FND00012 Drosulfakinins B2ZB98 Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Diptera Brachycera Muscomorpha Ephydroidea Drosophilidae Drosophila Sophophora Drosophila sechellia (Fruit fly) 40, 26 neuropeptide hormone activity, neuropeptide receptor binding 141 None Dsk 7238 extracellular region adult feeding behavior, adult locomotory behavior, larval locomotory behavior, multicellular organismal response to stress, neuromuscular junction development, neuropeptide signaling pathway, positive regulation of cytosolic calcium ion concentration, regulation of smooth muscle contraction, smooth muscle contraction 17632121;17632121 66 34:73, 86:111 TSLQNAKDDRRLQELESKIGAESDQPNANLVGPSFSRFGD, VPLISRPMIPIELDLLMDNDDERTKA
PSQ00226 FND00012 Drosulfakinins B2ZB99 Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Diptera Brachycera Muscomorpha Ephydroidea Drosophilidae Drosophila Sophophora Drosophila simulans (Fruit fly) 42, 26 neuropeptide hormone activity, neuropeptide receptor binding 141 None Dsk 7240 extracellular region adult feeding behavior, adult locomotory behavior, larval locomotory behavior, multicellular organismal response to stress, neuromuscular junction development, neuropeptide signaling pathway, positive regulation of cytosolic calcium ion concentration, regulation of smooth muscle contraction, smooth muscle contraction 17632121;17632121 68 32:73, 86:111 QTTSLQNAKDDRRLQELESKIGAESDQTNANLVGPSFSRFGD, VPLISRPMIPIELDLLMDNDDERTKA
PSQ00227 FND00012 Drosulfakinins B2ZBA0 Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Diptera Brachycera Muscomorpha Ephydroidea Drosophilidae Drosophila Sophophora Drosophila teissieri (Fruit fly) 40, 23 hormone activity 138 None Dsk 7243 extracellular region neuropeptide signaling pathway, smooth muscle contraction 17632121;17632121 63 34:73, 86:108 TSLQISKGDRRLQDLESNMGAESDQPNANLVGTSLSRFGD, VPRPIIPIELDLLMDNDDENTKA
PSQ00228 FND00012 Drosulfakinins B2ZBA1 Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Diptera Brachycera Muscomorpha Ephydroidea Drosophilidae Drosophila Sophophora Drosophila yakuba (Fruit fly) 43, 23 hormone activity 137 None Dsk 7245 extracellular region neuropeptide signaling pathway, smooth muscle contraction 17632121;17632121 66 32:74, 85:107 QTNLQTSKGDRRLQDLESNMGAESDQPNANLVRPSLSRFGDKR, VPRPMIPIELDLLMDNDDENTKA
PSQ00268 FD00141 Neurotrophin 1 B7TB45 Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Diptera Brachycera Muscomorpha Ephydroidea Drosophilidae Drosophila Sophophora Drosophila melanogaster (Fruit fly) 469 growth factor activity, receptor ligand activity, Toll binding 886 Neurotrophic factor 1 , Protein spaetzle 2 , Protein spatzle 2 NT1 7227 extracellular region, extracellular space axon guidance, central nervous system formation, innate immune response, motor neuron axon guidance, nervous system development, regulation of cell death, regulation of neuronal synaptic plasticity in response to neurotrophin, regulation of Toll signaling pathway, Toll signaling pathway 24124519 469 30:498 DDELMDFDFADSNDAAMEDWQLDDLEEAKKAEQAEKKLESNMLDFSVDLDEPEPEKQLPPFDWRERVLRNALAKALADEGLRQKFAEVLPILRMLSSQQRLALSALISAQMNAKKGHELKFEQVRMMFGNEKKLLLPIVFDIANLIKSSTRKYINLGSDLASSALYHTPINRREDDLTPEESQQDDQLGTIAVEVEPKKVSTEEVQLESLEDFFDEMGSEVLDPQMINEALTGDLHDNKTKTFKPENHGQRVRRSANEFVHKLTRSVPASVTEQQLLGGIAGRTIKLNTTAFQQPSSQEEEKMASSNGGQSYSEVEDLAFAGLNGTEIPLSADERLDLQRNSAEETEEPLPSPEELIAGPRYRLGKRPLPGQKSGSPIKRKRVTSSLRGRPKTAASSHKPVVTPPNKKCERFTSNMCIRTDDYPLEQIMGSIRRHKNAMSALLAEFYDKPNNNLEFSDDFDDFSLSKKR
PSQ00596 FD00131 Caspase-1 O02002 Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Diptera Brachycera Muscomorpha Ephydroidea Drosophilidae Drosophila Sophophora Drosophila melanogaster (Fruit fly) 13 BIR domain binding, cysteine-type endopeptidase activity, cysteine-type endopeptidase activity involved in apoptotic process, cysteine-type endopeptidase activity involved in execution phase of apoptosis 323 None Dcp-1 7227 cytoplasm, cytosol, messenger ribonucleoprotein complex, mitochondrion, neuronal cell body, neuronal ribonucleoprotein granule apoptotic process, cellular response to starvation, cytoplasmic transport, nurse cell to oocyte, execution phase of apoptosis, multicellular organism development, negative regulation of apoptotic process, negative regulation of neuromuscular synaptic transmission, neuron remodeling, nurse cell apoptotic process, oogenesis, ovarian nurse cell to oocyte transport, positive regulation of autophagy, positive regulation of macroautophagy, programmed cell death, programmed cell death involved in cell development 8999799 13 203:215 GGITLEKGVTETD
PSQ00636 FND00152 Bomanin Short 2 O77150 Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Diptera Brachycera Muscomorpha Ephydroidea Drosophilidae Drosophila Sophophora Drosophila melanogaster (Fruit fly) 7 None 45 Bomanin-2 , Immune-induced peptide 2 BomS2 7227 extracellular region defense response, innate immune response, response to bacterium 12171930 7 21:27 VPLSPDP
PSQ00807 FD00440 Protein decapentaplegic P07713 Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Diptera Brachycera Muscomorpha Ephydroidea Drosophilidae Drosophila Sophophora Drosophila melanogaster (Fruit fly) 433 BMP receptor binding, collagen binding, cytokine activity, growth factor activity, heparin binding, morphogen activity, protein heterodimerization activity, protein homodimerization activity, receptor ligand activity 588 None dpp 7227 cell leading edge, dense core granule lumen, extracellular space amnioserosa formation, anterior Malpighian tubule development, BMP signaling pathway, cardioblast differentiation, cell chemotaxis involved in Malpighian tubule morphogenesis, chorion-containing eggshell formation, compound eye morphogenesis, dorsal appendage formation, dorsal closure, dorsal/ventral axis specification, dorsal/ventral pattern formation, ectodermal cell fate specification, embryonic hindgut morphogenesis, epithelial cell migration, open tracheal system, eye-antennal disc development, eye-antennal disc morphogenesis, female germ-line stem cell population maintenance, fusion cell fate specification, genital disc anterior/posterior pattern formation, genital disc development, genital disc sexually dimorphic development, germ cell development, germ cell migration, germ-line stem cell division, germ-line stem cell population maintenance, head morphogenesis, heart development, hemocyte development, hindgut morphogenesis, imaginal disc development, imaginal disc-derived wing morphogenesis, imaginal disc-derived wing vein morphogenesis, imaginal disc-derived wing vein specification, labial disc development, larval lymph gland hemocyte differentiation, lymph gland development, male germ-line stem cell population maintenance, Malpighian tubule morphogenesis, maternal specification of dorsal/ventral axis, oocyte, soma encoded, mesoderm development, negative regulation of gene expression, negative regulation of salivary gland boundary specification, ovarian follicle cell development, pericardial nephrocyte differentiation, positive regulation of gene expression, positive regulation of imaginal disc growth, positive regulation of muscle organ development, positive regulation of pathway-restricted SMAD protein phosphorylation, positive regulation of SMAD protein signal transduction, progression of morphogenetic furrow involved in compound eye morphogenesis, R8 cell fate specification, regulation of cell differentiation, regulation of cell shape, regulation of imaginal disc growth, regulation of stem cell differentiation, regulation of tube diameter, open tracheal system, SMAD protein signal transduction, spectrosome organization, wing and notum subfield formation, wing disc pattern formation, zygotic specification of dorsal/ventral axis 1692958 433 24:456 EDISQRFIAAIAPVAAHIPLASASGSGSGRSGSRSVGASTSTALAKAFNPFSEPASFSDSDKSHRSKTNKKPSKSDANRQFNEVHKPRTDQLENSKNKSKQLVNKPNHNKMAVKEQRSHHKKSHHHRSHQPKQASASTESHQSSSIESIFVEEPTLVLDREVASINVPANAKAIIAEQGPSTYSKEALIKDKLKPDPSTLVEIEKSLLSLFNMKRPPKIDRSKIIIPEPMKKLYAEIMGHELDSVNIPKPGLLTKSANTVRSFTHKDSKIDDRFPHHHRFRLHFDVKSIPADEKLKAAELQLTRDALSQQVVASRSSANRTRYQVLVYDITRVGVRGQREPSYLLLDTKTVRLNSTDTVSLDVQPAVDRWLASPQRNYGLLVEVRTVRSLKPAPHHHVRLRRSADEAHERWQHKQPLLFTYTDDGRHKARSIR
PSQ01286 FD00538 Drosomycin P41964 Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Diptera Brachycera Muscomorpha Ephydroidea Drosophilidae Drosophila Sophophora Drosophila melanogaster (Fruit fly) 6 None 70 Cysteine-rich peptide Drs 7227 extracellular space antibacterial humoral response, antifungal humoral response, antimicrobial humoral immune response mediated by antimicrobial peptide, defense response, defense response to fungus, defense response to Gram-negative bacterium, defense response to protozoan, killing of cells of other organism, response to bacterium, response to wounding 7806546 6 21:26 ANEADA
PSQ01485 FND00157 Daisho1 P82705 Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Diptera Brachycera Muscomorpha Ephydroidea Drosophilidae Drosophila Sophophora Drosophila melanogaster (Fruit fly) 6 None 42 Immune-induced peptide 4 Dso1 7227 extracellular region, extracellular space cell morphogenesis, defense response, humoral immune response, innate immune response, positive regulation of antifungal innate immune response, response to bacterium, Toll signaling pathway 12171930, 9736738 6 21:26 EPVPQP
PSQ01486 FD00556 Bomanin Short 1 P82706 Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Diptera Brachycera Muscomorpha Ephydroidea Drosophilidae Drosophila Sophophora Drosophila melanogaster (Fruit fly) 7 None 45 Bomanin-1 , Immune-induced peptide 1 BomS1 7227 extracellular region defense response, innate immune response, response to bacterium 9736738 7 21:27 VPLSPDP
PSQ01751 FND00156 Neuropeptide CCHamide-1 Q4V4I9 Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Diptera Brachycera Muscomorpha Ephydroidea Drosophilidae Drosophila Sophophora Drosophila melanogaster (Fruit fly) 144 neuropeptide hormone activity 182 None CCHa1 7227 extracellular space neuropeptide signaling pathway 21214272, 23293632 144 39:182 SGGKAVIDAKQHPLPNSYGLDSVVEQLYNNNNNNQNNQDDDNNDDDSNRNTNANSANNIPLAAPAIISRRESEDRRIGGLKWAQLMRQHRYQLRQLQDQQQQGRGRGGQGQYDAAAESWRKLQQALQAQIDADNENYSGYELTK
PSQ01752 FND00301 Trissin Q4V645 Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Diptera Brachycera Muscomorpha Ephydroidea Drosophilidae Drosophila Sophophora Drosophila melanogaster (Fruit fly) 52 G protein-coupled receptor binding 108 None Trissin 7227 extracellular space G protein-coupled receptor signaling pathway 21939639 52 57:108 RKRSDPDALRQSSNRRLIDFILLQGRALFTQELRERRHNGTLMDLGLNTYYP
PSQ01958 FND00240 Neuropeptide CCHamide-2 Q8SXL2 Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Diptera Brachycera Muscomorpha Ephydroidea Drosophilidae Drosophila Sophophora Drosophila melanogaster (Fruit fly) 94 neuropeptide hormone activity 136 None CCHa2 7227 extracellular space neuropeptide signaling pathway 21214272, 23293632 94 43:136 SLSPGSGSGTGVGGGMGEAASGGQEPDYVRPNGLLPMMAPNEQVPLEGDFNDYPARQVLYKIMKSWFNRPRRPASRLGELDYPLANSAELNGVN
PSQ02081 FD00249 Serine protease 7 Q9V3Z2 Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Diptera Brachycera Muscomorpha Ephydroidea Drosophilidae Drosophila Sophophora Drosophila melanogaster (Fruit fly) 109 metal ion binding, serine-type endopeptidase activity 391 Melanization protease 2 Sp7 7227 extracellular region, extracellular space defense response to Gram-positive bacterium, melanization defense response, positive regulation of melanization defense response, proteolysis 24260243 109 28:136 QGSCRNPNQKQGQCLSIYDCQSLLSVIQQSYVSPEDRTFLRNSQCLDGVGRQPYVCCTSDRSFGSQEATSAAPPPTTTSSSSRGQDGQAGLGNLLPSPPKCGPHSFSNK
PSQ02082 FND00358 Neuropeptide F Q9VET0 Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Diptera Brachycera Muscomorpha Ephydroidea Drosophilidae Drosophila Sophophora Drosophila melanogaster (Fruit fly) 6, 37 G protein-coupled receptor binding, neuropeptide F receptor binding, neuropeptide hormone activity 102 dNPF NPF 7227 extracellular region circadian behavior, circadian rhythm, digestion, endocrine signaling, G protein-coupled receptor signaling pathway, larval feeding behavior, larval foraging behavior, larval locomotory behavior, locomotor rhythm, male courtship behavior, neuropeptide signaling pathway, olfactory behavior, regulation of response to food, response to odorant, social behavior 10499420;10499420 43 27:32, 66:102 SNSRPP, GSLMDILRNHEMDNINLGKNANNGGEFARGFNEEEIF
PSQ02083 FD00189 Serine protease HTRA2 Q9VFJ3 Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Diptera Brachycera Muscomorpha Ephydroidea Drosophilidae Drosophila Sophophora Drosophila melanogaster (Fruit fly) 57 peptidase activity, serine-type endopeptidase activity 422 High temperature requirement protein A2 , Omi stress-regulated endoprotease HtrA2 7227 cytosol, integral component of membrane, mitochondrial intermembrane space, mitochondrial membrane, mitochondrion, Nebenkern apoptotic process, ectopic germ cell programmed cell death, mitochondrion organization, positive regulation of apoptotic process, positive regulation of cysteine-type endopeptidase activity, regulation of apoptotic process, spermatogenesis 18259196 57 18:74 ASPVLHSHAANRRSSQLAIKEGDPNSNGNSGQYQQNGEQKEKGWRRLVRFFVPFSLG
PSQ02084 FND00209 Protein hugin Q9VG55 Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Diptera Brachycera Muscomorpha Ephydroidea Drosophilidae Drosophila Sophophora Drosophila melanogaster (Fruit fly) 95, 7 ecdysis-triggering hormone activity, hormone activity, myostimulatory hormone activity, neuropeptide receptor binding, signaling receptor binding 191 None Hug 7227 extracellular region, extracellular space ecdysis, chitin-based cuticle, larval feeding behavior, neuropeptide signaling pathway 12204246;12204246 102 25:119, 185:191 KSLQGTSKLDLGNHISAGSARGSLSPASPALSEARQKRAMGDYKELTDIIDELEENSLAQKASATMQVAAMPPQGQEFDLDTMPPLTYYLLLQKL, AQVCGGD
Go to Lab Web Page