Home Advance Search BLAST Contact Documentation/Help Feedback
Family
Protein Name
Uniprot ID
Taxonomy
Organism
Prosequence length
Functions
PreProtein length
Alt Name
Gene Name
NCBI ID
Cell Org
Process
PubMed
Total Proseq length
Proseq Loc
Prosequence Sequence

Proseq ID Family Protein Name Uniprot ID Taxonomy Organism Prosequence length Functions PreProtein length Alter Name Gene Name NCBI ID Cell Org Process PubMed Total Proseq length Proseq Loc Prosequence Sequence
PSQ02085 FND00197 Tachykinins Q9VGE8 Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Diptera Brachycera Muscomorpha Ephydroidea Drosophilidae Drosophila Sophophora Drosophila melanogaster (Fruit fly) 23 neuropeptide hormone activity, neurotransmitter transmembrane transporter activity, signaling receptor binding, tachykinin receptor binding 289 dTk Tk 7227 extracellular space adult walking behavior, inter-male aggressive behavior, lipid metabolic process, neuropeptide signaling pathway, positive regulation of hindgut contraction, positive regulation of sensory perception of pain, response to pheromone, sensory perception of smell, tachykinin receptor signaling pathway 10801863 23 25:47 ADTETESSGSPLTPGAEEPRRVV
PSQ02086 FD00141 Protein spaetzle 5 Q9VZX1 Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Diptera Brachycera Muscomorpha Ephydroidea Drosophilidae Drosophila Sophophora Drosophila melanogaster (Fruit fly) 255 growth factor activity, receptor ligand activity, Toll binding 387 Neurotrophic factor 2 , Protein spatzle 5 spz5 7227 extracellular region, extracellular space axon guidance, central nervous system formation, innate immune response, motor neuron axon guidance, nervous system development, positive regulation of antimicrobial peptide production, regulation of cell death, regulation of neuronal synaptic plasticity in response to neurotrophin, regulation of synaptic plasticity, regulation of Toll signaling pathway, Toll signaling pathway 23892553 255 30:284 HSSPPPCGLYGAPPCQFLPAPPGQTPTCARPGKTYCEHADNYPTYLIKSLVRKWGYEAATLLVDETWEDFAAVAWHDTPVFYDPKSIFPPRDPAAQDFNGYSYQTPFGGNPQRPSGGGNPLFVSNPSTEAPTYLLYTSSGGGHRSGHRYNSQGGGTSSSGGHLYINQSDKSTPYNATLWLKRLVRDLSRKQRQPDEVQAEVVEPVNEQTEEAEEQDNPAEDHPQSKRDVSLNMDLLDIVGVEAPNPLKKRSRTKR
PSQ02093 FD00502 Caspase Dronc Q9XYF4 Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Diptera Brachycera Muscomorpha Ephydroidea Drosophilidae Drosophila Sophophora Drosophila melanogaster (Fruit fly) 134 CARD domain binding, cysteine-type endopeptidase activity, cysteine-type endopeptidase activity involved in apoptotic process, cysteine-type endopeptidase activity involved in apoptotic signaling pathway, cysteine-type endopeptidase activity involved in execution phase of apoptosis, endopeptidase activity, protein homodimerization activity 450 NEDD2-like caspase Dronc 7227 apoptosome, cytoplasm, nucleus, plasma membrane activation of cysteine-type endopeptidase activity involved in apoptotic process, apoptotic process, central nervous system development, chaeta development, compound eye development, dendrite morphogenesis, determination of adult lifespan, ectopic germ cell programmed cell death, embryonic development via the syncytial blastoderm, execution phase of apoptosis, head involution, hemocyte development, melanization defense response, metamorphosis, negative regulation of cell population proliferation, neuron remodeling, nurse cell apoptotic process, positive regulation of apoptotic process, positive regulation of compound eye retinal cell programmed cell death, positive regulation of cysteine-type endopeptidase activity involved in apoptotic signaling pathway, positive regulation of necrotic cell death, programmed cell death, programmed cell death involved in cell development, protein autoprocessing, regulation of autophagy, regulation of cell death, salivary gland histolysis, sperm individualization, zymogen activation 10200258 134 1:134 MQPPELEIGMPKRHREHIRKNLNILVEWTNYERLAMECVQQGILTVQMLRNTQDLNGKPFNMDEKDVRVEQHRRLLLKITQRGPTAYNLLINALRNINCLDAAVLLESVDESDSRPPFISLNERRTSRKSADIV