Proseq ID | Family | Protein Name ![]() |
Uniprot ID | Taxonomy | Organism | Prosequence length![]() |
Functions | PreProtein length | Alter Name | Gene Name | NCBI ID | Cell Org | Process | PubMed | Total Proseq length | Proseq Loc | Prosequence Sequence | |
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
PSQ02085 | FND00197 | Tachykinins | Q9VGE8 | Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Diptera Brachycera Muscomorpha Ephydroidea Drosophilidae Drosophila Sophophora | Drosophila melanogaster (Fruit fly) | 23 | neuropeptide hormone activity, neurotransmitter transmembrane transporter activity, signaling receptor binding, tachykinin receptor binding | 289 | dTk | Tk | 7227 | extracellular space | adult walking behavior, inter-male aggressive behavior, lipid metabolic process, neuropeptide signaling pathway, positive regulation of hindgut contraction, positive regulation of sensory perception of pain, response to pheromone, sensory perception of smell, tachykinin receptor signaling pathway | 10801863 | 23 | 25:47 | ADTETESSGSPLTPGAEEPRRVV | |
PSQ02086 | FD00141 | Protein spaetzle 5 | Q9VZX1 | Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Diptera Brachycera Muscomorpha Ephydroidea Drosophilidae Drosophila Sophophora | Drosophila melanogaster (Fruit fly) | 255 | growth factor activity, receptor ligand activity, Toll binding | 387 | Neurotrophic factor 2 , Protein spatzle 5 | spz5 | 7227 | extracellular region, extracellular space | axon guidance, central nervous system formation, innate immune response, motor neuron axon guidance, nervous system development, positive regulation of antimicrobial peptide production, regulation of cell death, regulation of neuronal synaptic plasticity in response to neurotrophin, regulation of synaptic plasticity, regulation of Toll signaling pathway, Toll signaling pathway | 23892553 | 255 | 30:284 | HSSPPPCGLYGAPPCQFLPAPPGQTPTCARPGKTYCEHADNYPTYLIKSLVRKWGYEAATLLVDETWEDFAAVAWHDTPVFYDPKSIFPPRDPAAQDFNGYSYQTPFGGNPQRPSGGGNPLFVSNPSTEAPTYLLYTSSGGGHRSGHRYNSQGGGTSSSGGHLYINQSDKSTPYNATLWLKRLVRDLSRKQRQPDEVQAEVVEPVNEQTEEAEEQDNPAEDHPQSKRDVSLNMDLLDIVGVEAPNPLKKRSRTKR | |
PSQ02093 | FD00502 | Caspase Dronc | Q9XYF4 | Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Diptera Brachycera Muscomorpha Ephydroidea Drosophilidae Drosophila Sophophora | Drosophila melanogaster (Fruit fly) | 134 | CARD domain binding, cysteine-type endopeptidase activity, cysteine-type endopeptidase activity involved in apoptotic process, cysteine-type endopeptidase activity involved in apoptotic signaling pathway, cysteine-type endopeptidase activity involved in execution phase of apoptosis, endopeptidase activity, protein homodimerization activity | 450 | NEDD2-like caspase | Dronc | 7227 | apoptosome, cytoplasm, nucleus, plasma membrane | activation of cysteine-type endopeptidase activity involved in apoptotic process, apoptotic process, central nervous system development, chaeta development, compound eye development, dendrite morphogenesis, determination of adult lifespan, ectopic germ cell programmed cell death, embryonic development via the syncytial blastoderm, execution phase of apoptosis, head involution, hemocyte development, melanization defense response, metamorphosis, negative regulation of cell population proliferation, neuron remodeling, nurse cell apoptotic process, positive regulation of apoptotic process, positive regulation of compound eye retinal cell programmed cell death, positive regulation of cysteine-type endopeptidase activity involved in apoptotic signaling pathway, positive regulation of necrotic cell death, programmed cell death, programmed cell death involved in cell development, protein autoprocessing, regulation of autophagy, regulation of cell death, salivary gland histolysis, sperm individualization, zymogen activation | 10200258 | 134 | 1:134 | MQPPELEIGMPKRHREHIRKNLNILVEWTNYERLAMECVQQGILTVQMLRNTQDLNGKPFNMDEKDVRVEQHRRLLLKITQRGPTAYNLLINALRNINCLDAAVLLESVDESDSRPPFISLNERRTSRKSADIV |