Details of PSQ00422
| ProSeqID |
PSQ00422 |
| Family |
FD00001 |
| Protein Name |
U3-theraphotoxin-Hhn1a 17 |
| UniProt ID |
D2Y2N0
|
| Taxonomy |
Eukaryota-Metazoa-Ecdysozoa-Arthropoda-Chelicerata-Arachnida-Araneae-Mygalomorphae-Theraphosidae-Haplopelma |
| Organisms |
Cyriopagopus hainanus (Chinese bird spider) (Haplopelma hainanum) |
| Prosequence Length (aa) |
28 |
| Functions |
ion channel inhibitor activity, toxin activity |
| Preproprotein Length (aa) |
87 |
| Alt Name |
Hainantoxin-VIII, Peptide F4-27 |
| Gene Name |
None |
| NCBI ID |
209901 |
| Cellular Localization |
extracellular region |
| Processes |
pathogenesis |
| PubMed |
20192277
|
| Total Prosequence Length (aa) |
28 |
| Prosequence Location |
25:52 |
| Prosequence Sequence |
SESEEKEFPKEMLSSIFAVDNDFKQEER |
| Preproprotein Sequence |
MVNVKASMFLTFAGLVLLFVVCYASESEEKEFPKEMLSSIFAVDNDFKQEERDCAGYMRECKEKLCCSGYVCSSRWKWCVLPAPWRR |