Details of PSQ00443
| ProSeqID |
PSQ00443 |
| Family |
FD00032 |
| Protein Name |
Brevinin-1CG4 |
| UniProt ID |
E1AWD3
|
| Taxonomy |
Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Amphibia-Batrachia-Anura-Neobatrachia-Ranoidea-Ranidae-Amolops |
| Organisms |
Amolops chunganensis (Chungan torrent frog) (Hylorana chunganensis) |
| Prosequence Length (aa) |
23 |
| Functions |
None |
| Preproprotein Length (aa) |
71 |
| Alt Name |
None |
| Gene Name |
None |
| NCBI ID |
325556 |
| Cellular Localization |
extracellular region |
| Processes |
defense response to bacterium, defense response to fungus, hemolysis in other organism |
| PubMed |
22951323
|
| Total Prosequence Length (aa) |
23 |
| Prosequence Location |
23:45 |
| Prosequence Sequence |
EQERNADEEERRDDSDKRDVEVE |
| Preproprotein Sequence |
MFTLKKSLLLLFFLGTINLSLCEQERNADEEERRDDSDKRDVEVEKRFLSTLLNVASKVVPTLFCKITKKC |