| ProSeqID | PSQ01941 |
| Family | FND00196 |
| Protein Name | Precursor of CEP1 |
| UniProt ID | Q8L8Y3 |
| Taxonomy | Eukaryota-Viridiplantae-Streptophyta-Embryophyta-Tracheophyta-Spermatophyta-Magnoliopsida-Eudicotyledons-Gunneridae-Pentapetalae-Rosids-Malvids-Brassicales-Brassicaceae-Camelineae-Arabidopsis |
| Organisms | Arabidopsis thaliana (Mouse-ear cress) |
| Prosequence Length (aa) | 43 |
| Functions | hormone activity |
| Preproprotein Length (aa) | 91 |
| Alt Name | None |
| Gene Name | CEP1 |
| NCBI ID | 3702 |
| Cellular Localization | apoplast, extracellular region, extracellular space |
| Processes | cell-cell signaling involved in cell fate commitment, cellular response to ammonium ion, cellular response to nitrogen starvation, lateral root development, negative regulation of cell division, negative regulation of cell growth, nitrate import, photoperiodism, flowering, regulation of leaf morphogenesis, regulation of root development, response to auxin, response to nitrate starvation, response to nitrogen compound, response to osmotic stress, response to salt stress, root development |
| PubMed | 25324386 |
| Total Prosequence Length (aa) | 43 |
| Prosequence Location | 29:71 |
| Prosequence Sequence | RHLKTTSLEIEGIYKKTEAEHPSIVVTYTRRGVLQKEVIAHPT |
| Preproprotein Sequence | MGMSNRSVSTSIFFLALVVLHGIQDTEERHLKTTSLEIEGIYKKTEAEHPSIVVTYTRRGVLQKEVIAHPTDFRPTNPGNSPGVGHSNGRH |