Proseq ID | Family | Protein Name ![]() |
Uniprot ID | Taxonomy | Organism | Prosequence length![]() |
Functions | PreProtein length | Alter Name | Gene Name | NCBI ID | Cell Org | Process | PubMed | Total Proseq length | Proseq Loc | Prosequence Sequence | |
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
PSQ01131 | FD00471 | Lantibiotic gallidermin | P21838 | Bacteria Firmicutes Bacilli Bacillales Staphylococcaceae Staphylococcus | Staphylococcus gallinarum | 30 | signaling receptor binding | 59 | None | gdmA | 1293 | extracellular region | cytolysis, defense response to bacterium | 3181159 | 30 | 1:30 | MEAVKEKNELFDLDVKVNAKESNDSGAEPR | |
PSQ01138 | FD00198 | Germination protease | P22321 | Bacteria Firmicutes Bacilli Bacillales Bacillaceae Bacillus | Bacillus megaterium (strain ATCC 12872 | 15 | metalloendopeptidase activity | 370 | GPR endopeptidase, Germination proteinase, Spore protease | gpr | 545693 | None | spore germination | 1840582 | 15 | 1:15 | MEKELDLSQYSVRTD | |
PSQ01139 | FD00198 | Germination protease | P22322 | Bacteria Firmicutes Bacilli Bacillales Bacillaceae Bacillus | Bacillus subtilis (strain 168) | 16 | metalloendopeptidase activity | 368 | GPR endopeptidase, Germination proteinase, Spore protease | gpr | 224308 | None | spore germination | 8478323 | 16 | 1:16 | MKKSELDVNQYLIRTD | |
PSQ01144 | FD00536 | Colicin-V | P22522 | Bacteria Proteobacteria Gammaproteobacteria Enterobacterales Enterobacteriaceae Escherichia | Escherichia coli | 15 | None | 103 | Microcin-V bacteriocin | cvaC | 562 | extracellular region | cytolysis, defense response to bacterium | 7952189, 8204625 | 15 | 1:15 | MRTLTLNELDSVSGG | |
PSQ01148 | FD00242 | Toxin coregulated pilin | P23024 | Bacteria Proteobacteria Gammaproteobacteria Vibrionales Vibrionaceae Vibrio | Vibrio cholerae | 25 | None | 224 | Pilus colonization factor | tcpA | 666 | extracellular organelle, integral component of membrane, pilus | pathogenesis | 2883655 | 25 | 1:25 | MQLLKQLFKKKFVKEEHDKKTGQEG | |
PSQ01150 | FND00332 | Photosystem I reaction center subunit VIII | P23079 | Bacteria Cyanobacteria Nostocales Nostocaceae Trichormus | Trichormus variabilis (strain ATCC 29413 | 11 | None | 46 | None | psaI | 240292 | integral component of membrane, photosystem I, plasma membrane-derived thylakoid membrane | photosynthesis | 1908790 | 11 | 1:11 | MATAFLPSILA | |
PSQ01152 | FD00358 | Photosystem I reaction center subunit PsaK | P23317 | Bacteria Cyanobacteria Nostocales Nostocaceae Trichormus | Trichormus variabilis (strain ATCC 29413 | 8 | None | 86 | Light-harvesting 6, Photosystem I subunit X | psaK | 240292 | integral component of membrane, photosystem I, plasma membrane-derived thylakoid membrane | photosynthesis | 1908790 | 8 | 1:8 | MLTSTLLA | |
PSQ01155 | FND00304 | Bacteriocin lactacin-F subunit LafA | P24022 | Bacteria Firmicutes Bacilli Lactobacillales Lactobacillaceae Lactobacillus | Lactobacillus johnsonii (strain CNCM I-12250 | 18 | None | 75 | None | lafA | 257314 | None | cytolysis, defense response to bacterium | 1903624 | 18 | 1:18 | MKQFNYLSHKDLAVVVGG | |
PSQ01161 | FD00474 | Lysozyme M1 | P25310 | Bacteria Actinobacteria Streptomycetales Streptomycetaceae Streptomyces | Streptomyces globisporus | 193 | lysozyme activity | 300 | 1 | acm | 1908 | extracellular region | cell wall macromolecule catabolic process, cytolysis, defense response to bacterium, peptidoglycan catabolic process | 2341041 | 193 | 77:269 | ADTSGVQGIDVSHWQGSINWSSVKSAGMSFAYIKATEGTNYKDDRFSANYTNAYNAGIIRGAYHFARPNASSGTAQADYFASNGGGWSRDNRTLPGVLDIEHNPSGAMCYGLSTTQMRTWINDFHARYKARTTRDVVIYTTASWWNTCTGSWNGMAAKSPFWVAHWGVSAPTVPSGFPTWTFWQYSATGRVGG | |
PSQ01168 | FD00486 | Auracyanin-B | P27197 | Bacteria Chloroflexi Chloroflexia Chloroflexales Chloroflexineae Chloroflexaceae Chloroflexus | Chloroflexus aurantiacus (strain ATCC 29366 | 24 | copper ion binding, electron transfer activity, oxidoreductase activity | 240 | None | None | 324602 | plasma membrane | photosynthetic electron transport chain | 1313011 | 24 | 57:80 | TAGGFVAATPRPTATPRPTAAPAP | |
PSQ01171 | FD00304 | Beta-lytic metalloendopeptidase | P27458 | Bacteria Proteobacteria Betaproteobacteria Burkholderiales Alcaligenaceae Achromobacter | Achromobacter lyticus | 171 | metal ion binding, metalloendopeptidase activity | 374 | Beta-lytic protease | None | 224 | extracellular region | None | 2228973 | 171 | 25:195 | ARRATAQRRGSGVFYDEMFDFDIDAHLAKHAPHLHKHSEEISHWAGYSGISRSVDRADGAAERAVTPSARRIVRSASWRAPTASARRPARSRWRCASRCTSAIPTRQGAGDAGPRQSAAGAVRAFRRQRAGGRAARRRRVPAGLRPPVQRTAPGQGGFGPLRQGRPGRAAV | |
PSQ01188 | FD00414 | Gingipain R1 | P28784 | Bacteria Bacteroidetes Bacteroidia Bacteroidales Porphyromonadaceae Porphyromonas | Porphyromonas gingivalis | 203 | calcium ion binding, calcium-dependent cysteine-type endopeptidase activity | 991 | Arg-gingipain, Gingipain 1, RGP-1 | rgpA | 837 | extracellular region | pathogenesis, proteolysis | 1527017, 7864651 | 203 | 25:227 | QTELGRNPNVRLLESTQQSVTKVQFRMDNLKFTEVQTPKGMAQVPTYTEGVNLSEKGMPTLPILSRSLAVSDTREMKVEVVSSKFIEKKNVLIAPSKGMIMRNEDPKKIPYVYGKSYSQNKFFPGEIATLDDPFILRDVRGQVVNFAPLQYNPVTKTLRIYTEITVAVSETSEQGKNILNKKGTFAGFEDTYKRMFMNYEPGR | |
PSQ01193 | FD00388 | Carboxypeptidase T | P29068 | Bacteria Firmicutes Bacilli Bacillales Thermoactinomycetaceae Thermoactinomyces | Thermoactinomyces vulgaris | 75 | metallocarboxypeptidase activity, zinc ion binding | 424 | None | cpt | 2026 | None | None | 6424730 | 75 | 24:98 | FSQNIENPSIFDLGIKLYKIDGVSTKEQRSAIASTGAAIEEVGKDYVKVLATPSEAKQIKQKGFTATVDTSLTTQ | |
PSQ01196 | FD00248 | Minor extracellular protease vpr | P29141 | Bacteria Firmicutes Bacilli Bacillales Bacillaceae Bacillus | Bacillus subtilis (strain 168) | 132 | serine-type endopeptidase activity | 806 | None | vpr | 224308 | extracellular region | None | 10658653, 1938892 | 132 | 29:160 | APASSKTSADLEKAEVFGDIDMTTSKKTTVIVELKEKSLAEAKEAGESQSKSKLKTARTKAKNKAIKAVKNGKVNREYEQVFSGFSMKLPANEIPKLLAVKDVKAVYPNVTYKTDNMKDKDVTISEDAVSPQ | |
PSQ01197 | FD00049 | Bacillolysin | P29148 | Bacteria Firmicutes Bacilli Bacillales Paenibacillaceae Paenibacillus | Paenibacillus polymyxa (Bacillus polymyxa) | 262 | metal ion binding, metalloendopeptidase activity | 590 | Neutral protease | npr | 1406 | extracellular region | None | 1834632 | 262 | 25:286 | ESSVSGPAQLTPTFHTEQWKAPSSVSGDDIVWSYLNRQKKSLLGVDSSSVREQFRIVDRTSDKSGVSHYRLKQYVNGIPVYGAEQTIHVGKSGEVTSYLGAVINEDQQEEATQGTTPKISASEAVYTAYKEAAARIEALPTSDDTISKDAEEPSSVSKDTYAEAANNDKTLSVDKDELSLDKASVLKDSKIEAVEAEKSSIAKIANLQPEVDPKAELYYYPKGDDLLLVYVTEVNVLEPAPLRTRYIIDANDGSIVFQYDII | |
PSQ01199 | FD00074 | Bacteriocin pediocin PA-1 | P29430 | Bacteria Firmicutes Bacilli Lactobacillales Lactobacillaceae Pediococcus Pediococcus acidilactici group | Pediococcus acidilactici | 18 | None | 62 | Pediocin ACH | pedA | 1254 | extracellular region | cytolysis, defense response to bacterium | 1402795, 1575516 | 18 | 1:18 | MKKIEKLTEKEMANIIGG | |
PSQ01201 | FD00108 | Aculeacin-A acylase | P29958 | Bacteria Actinobacteria Micromonosporales Micromonosporaceae Actinoplanes | Actinoplanes utahensis | 12, 15 | hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides | 786 | None | aac | 1869 | extracellular region | antibiotic biosynthetic process | 1398088;1398088 | 27 | 23:34, 215:229 | AVPSPASGREHD, AAIAAALDGTSAGIG | |
PSQ01218 | FD00156 | Penicillin G acylase | P31956 | Bacteria Proteobacteria Alphaproteobacteria Rhizobiales Rhizobiaceae Rhizobium/Agrobacterium group Rhizobium | Arthrobacter viscosus | 31 | metal ion binding, penicillin amidase activity | 802 | Penicillin G amidase, Penicillin G amidohydrolase | pac | 1673 | extracellular region | antibiotic biosynthetic process, response to antibiotic | 3214149 | 31 | 235:265 | SAVIKASEKVGKERENFVQSSEELGLPLKIG | |
PSQ01231 | FD00206 | Major structural subunit of bundle-forming pilus | P33553 | Bacteria Proteobacteria Gammaproteobacteria Enterobacterales Enterobacteriaceae Escherichia | Escherichia coli O127 | 13 | None | 193 | Bundle-forming pilin | bfpA | 574521 | integral component of membrane, pilus | None | 1683004 | 13 | 1:13 | MVSKIMNKKYEKG | |
PSQ01232 | FD00074 | Bacteriocin leucocin-A | P34034 | Bacteria Firmicutes Bacilli Lactobacillales Leuconostocaceae Leuconostoc | Leuconostoc gelidum | 24 | None | 61 | Leucocin A-UAL 187 | lcnA | 1244 | extracellular region | cytolysis, defense response to bacterium | 1840587 | 24 | 1:24 | MMNMKPTESYEQLDNSALEQVVGG |