Home Advance Search BLAST Contact Documentation/Help Feedback
Family
Protein Name
Uniprot ID
Taxonomy
Organism
Prosequence length
Functions
PreProtein length
Alt Name
Gene Name
NCBI ID
Cell Org
Process
PubMed
Total Proseq length
Proseq Loc
Prosequence Sequence

Proseq ID Family Protein Name Uniprot ID Taxonomy Organism Prosequence length Functions PreProtein length Alter Name Gene Name NCBI ID Cell Org Process PubMed Total Proseq length Proseq Loc Prosequence Sequence
PSQ00549 FD00002 Palustrin-2AJ2 G3F828 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Ranoidea Ranidae Amolops Amolops jingdongensis (Chinese torrent frog) 18 antioxidant activity 71 None None 1077530 extracellular region defense response to Gram-negative bacterium, defense response to Gram-positive bacterium, hemolysis in other organism, killing of cells of other organism 21816202 18 23:40 EQERAADDDEGEVIEEEV
PSQ00575 FD00002 Dermaseptin-1 J7H8J4 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Hyloidea Hylidae Phyllomedusinae Pithecopus Pithecopus nordestinus (Northeastern Brazilian leaf frog) (Phyllomedusa, nordestina) 21 None 73 None None 2034992 extracellular region defense response to bacterium 24113627 21 23:43 EEEKRENEGEEEQEDDEQSEM
PSQ00583 FND00141 Frenatin 2 L0L3V3 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Hyloidea Hylidae Hylinae Dendropsophini Sphaenorhynchus Sphaenorhynchus lacteus (Orinoco lime treefrog) (Hyla lactea) 32 DNA binding 71 None None 279984 extracellular region defense response to bacterium, innate immune response, regulation of defense response to virus 24704757 32 23:54 EREKREEEEEEEEENKEEEANEEGKGESEEKR
PSQ00584 FND00257 Senegalin L0P323 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Microhyloidea Hyperoliidae Kassina Kassina senegalensis (Senegal running frog) 33 None 76 None None 8415 extracellular region defense response to bacterium, defense response to fungus, killing of cells of other organism 23430307 33 23:55 NKRSDGKRADEEGEDKRADEEGEDKRADEEGED
PSQ00585 FD00002 Medusin-C1 L0P329 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Hyloidea Hylidae Phyllomedusinae Agalychnis Agalychnis callidryas (Red-eyed tree frog) (Phyllomedusa callidryas) 27 None 68 Medusin-AC , Phyllin-AC None 197464 extracellular region defense response to bacterium, defense response to fungus, hemolysis in other organism, innate immune response 23415652 27 23:49 EEEKRESEEEKNEQEEDDREERSEEKR
PSQ00586 FND00022 Medusin-DA1 L0P3K3 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Hyloidea Hylidae Phyllomedusinae Agalychnis Agalychnis dacnicolor (Giant mexican leaf frog) (Pachymedusa dacnicolor) 26 None 68 Medusin-PD , Phyllin-PD None 75988 extracellular region defense response to bacterium, defense response to fungus, innate immune response, killing of cells of other organism 23415652 26 23:48 EEEKRENEEEKNEQEEDDREERNEEK
PSQ00587 FND00022 Medusin-H1 L0P402 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Hyloidea Hylidae Phyllomedusinae Pithecopus Pithecopus hypochondrialis (Orange-legged leaf frog) (Phyllomedusa, hypochondrialis) 26 None 67 Medusin-PH , Phyllin-PH None 317381 extracellular region defense response to bacterium, defense response to fungus, hemolysis in other organism, innate immune response 23415652 26 23:48 EEEKRETEEKENEQEDDREERREEKR
PSQ00588 FD00002 [Thr6]-bradykinyl-Val,Asp L0PIN3 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Hyloidea Hylidae Phyllomedusinae Agalychnis Agalychnis dacnicolor (Giant mexican leaf frog) (Pachymedusa dacnicolor) 28 B1 bradykinin receptor binding, B2 bradykinin receptor binding, toxin activity 61 Bradykinin-related peptide RD-11 None 75988 extracellular region defense response, negative regulation of artery smooth muscle contraction, positive regulation of small intestine smooth muscle contraction, positive regulation of smooth muscle contraction involved in micturition, positive regulation of uterine smooth muscle contraction, vasodilation 24394432 28 23:50 EEEKREDEEEENEREENKESEEKRNQEE
PSQ00589 FND00010 [Thr6]-bradykinyl-Val,Asp L0PJV8 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Hyloidea Hylidae Phyllomedusinae Agalychnis Agalychnis callidryas (Red-eyed tree frog) (Phyllomedusa callidryas) 28 B1 bradykinin receptor binding, B2 bradykinin receptor binding, toxin activity 61 Bradykinin-related peptide RD-11 None 197464 extracellular region defense response, negative regulation of artery smooth muscle contraction, positive regulation of small intestine smooth muscle contraction, positive regulation of smooth muscle contraction involved in micturition, positive regulation of uterine smooth muscle contraction, vasodilation 24394432 28 23:50 EEEKRETEEEENEDEMDKESEEKRESPE
PSQ00594 FND00271 Tachykinin-like peptide M9P2C1 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Ranoidea Rhacophoridae Rhacophorinae Theloderma Theloderma corticale (Kwangsi warty tree frog) (Theloderma kwangsiense) 32, 26 None 91 Tachykinin-Thel None 126966 extracellular region defense response, neuropeptide signaling pathway, tachykinin receptor signaling pathway 23829212;23829212 58 20:51, 66:91 AEIGLNDEPEWYSDQIQEDLPVFENFLQRIAR, NNGFGQMSRKRSAERNTIHNYERRRK
PSQ00647 FND00016 Plasticin-DA1 O93454 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Hyloidea Hylidae Phyllomedusinae Agalychnis Agalychnis dacnicolor (Giant mexican leaf frog) (Pachymedusa dacnicolor) 20 None 71 Dermaseptin PD-3-6 None 75988 extracellular region, membrane, other organism cell membrane defense response, hemolysis in other organism 15222751 20 23:42 EAEKREEENEEKQEDDDESE
PSQ00715 FD00055 Preprocaerulein type-4 P01357 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Pipoidea Pipidae Xenopodinae Xenopus Xenopus Xenopus laevis (African clawed frog) 46, 51, 51 hormone activity 240 Preprocaerulein type IV None 8355 extracellular region defense response 5413288;5413288;5413288 148 27:72, 101:151, 165:215 DEERDVRGLASLLGKALKATLKIGTHFLGGAPQQREANDERRFADG, DDEDDVHERDVRGFGSFLGKALKAALKIGANALGGAPQQREANDERRFADG, DDEDDVNERDVRGFGSFLGKALKAALKIGANALGGSPQQREANDERRFADG
PSQ00766 FD00055 Preprocaerulein type-1 P05222 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Pipoidea Pipidae Xenopodinae Xenopus Xenopus Xenopus laevis (African clawed frog) 144 hormone activity 188 Preprocaerulein type I None 8355 extracellular region defense response 5413288 144 27:170 DEERDVRGLASFLGKALKAGLKIGAHLLGGAPQQREANDERRFADDDDDVNERDVRGFASFLGKALKAALKIGANMLGGTPQQREANDERRFADDEDDVNERDVRGFGSFLGKALKAALKIGANALGGSPQQREANDERRFADG
PSQ00767 FD00055 Preprocaerulein type-3 P05224 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Pipoidea Pipidae Xenopodinae Xenopus Xenopus Xenopus laevis (African clawed frog) 46, 51 hormone activity 169 Preprocaerulein type III None 8355 extracellular region defense response 5413288;5413288 97 27:72, 101:151 DEERDVRGLASLLGKALKAGLKIGTHFLGGAPQQREANDERRFADG, DDEDDVNERDVRGFGSFLGKALKAALKIGANALGGAPQQREANDERRFADG
PSQ00768 FND00335 Preprocaerulein clone PXC202 P05225 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Pipoidea Pipidae Xenopodinae Xenopus Xenopus Xenopus laevis (African clawed frog) 9, 51, 51, 22 hormone activity 187 None None 8355 extracellular region defense response 5413288;5413288;5413288;5413288 133 1:9, 23:73, 87:137, 166:187 NDERRFADG, DDEDDVNERDVRGFGSFLGKALKAALKIGANALGGSPQQREANDERRFADG, DDEDDVNERDVRGFGSFLGKALKAALKIGANALGGSLQQREVNDERRFADG, DDEDDVHERDVRGFGSFLGKAL
PSQ00769 FD00055 Preprocaerulein type-4 P05226 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Pipoidea Pipidae Xenopodinae Xenopus Xenopus Xenopus borealis (Kenyan clawed frog) 47, 51, 51 hormone activity 240 Preprocaerulein type IV None 8354 extracellular region defense response 5413288;5413288;5413288 149 27:73, 87:137, 166:216 DEEERDVRGLASLLGKALKAALKIGANALGGSPQQREANDERRFADG, DDEDDVNERDVRGFGSFLGKALKAGLKIGTHFLGGAPQQREANDERRFADG, DDEDDVHERDVRGFGSFLGKALKAALKIGANALGGSPQQREANDERRFADG
PSQ00790 FND00312 Xenopsin peptides P07198 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Pipoidea Pipidae Xenopodinae Xenopus Xenopus Xenopus laevis (African clawed frog) 9 None 81 None None 8355 extracellular region defense response to bacterium 4783175 9 65:73 EAMLRSAEA
PSQ00876 FD00003 Delta-conotoxin-like Ac6 P0C8V6 Eukaryota Metazoa Spiralia Lophotrochozoa Mollusca Gastropoda Caenogastropoda Neogastropoda Conoidea Conidae Conus Pionoconus Conus achatinus (Little frog cone) 29 sodium channel inhibitor activity, toxin activity 83 None None 369967 extracellular region pathogenesis 18286662 29 23:51 DDSRYGLKNLFPKARHEMKNPEASKLNKR
PSQ00877 FD00003 Omega-conotoxin-like Ac6 P0C8V9 Eukaryota Metazoa Spiralia Lophotrochozoa Mollusca Gastropoda Caenogastropoda Neogastropoda Conoidea Conidae Conus Pionoconus Conus achatinus (Little frog cone) 20 ion channel inhibitor activity, toxin activity 78 None None 369967 extracellular region pathogenesis 18286662 20 23:42 DDSRGTQKHRSLRSTTKVSK
PSQ00898 FND00145 Conopeptide-Ac1 P0CH24 Eukaryota Metazoa Spiralia Lophotrochozoa Mollusca Gastropoda Caenogastropoda Neogastropoda Conoidea Conidae Conus Pionoconus Conus achatinus (Little frog cone) 34 toxin activity 66 5P1 , 5P2 , Conopeptide Ac3, Conotoxin-Ac1 , Conotoxin-Ac1-O6P None 369967 extracellular region, host cell postsynaptic membrane None 32111068 34 18:51 QLDGDQTADRHAGERDQDPLEQYRNLKHVLRRTR
Go to Lab Web Page