Details of PSQ02093
| ProSeqID |
PSQ02093 |
| Family |
FD00502 |
| Protein Name |
Caspase Dronc |
| UniProt ID |
Q9XYF4
|
| Taxonomy |
Eukaryota-Metazoa-Ecdysozoa-Arthropoda-Hexapoda-Insecta-Pterygota-Neoptera-Holometabola-Diptera-Brachycera-Muscomorpha-Ephydroidea-Drosophilidae-Drosophila-Sophophora |
| Organisms |
Drosophila melanogaster (Fruit fly) |
| Prosequence Length (aa) |
134 |
| Functions |
CARD domain binding, cysteine-type endopeptidase activity, cysteine-type endopeptidase activity involved in apoptotic process, cysteine-type endopeptidase activity involved in apoptotic signaling pathway, cysteine-type endopeptidase activity involved in execution phase of apoptosis, endopeptidase activity, protein homodimerization activity |
| Preproprotein Length (aa) |
450 |
| Alt Name |
NEDD2-like caspase |
| Gene Name |
Dronc |
| NCBI ID |
7227 |
| Cellular Localization |
apoptosome, cytoplasm, nucleus, plasma membrane |
| Processes |
activation of cysteine-type endopeptidase activity involved in apoptotic process, apoptotic process, central nervous system development, chaeta development, compound eye development, dendrite morphogenesis, determination of adult lifespan, ectopic germ cell programmed cell death, embryonic development via the syncytial blastoderm, execution phase of apoptosis, head involution, hemocyte development, melanization defense response, metamorphosis, negative regulation of cell population proliferation, neuron remodeling, nurse cell apoptotic process, positive regulation of apoptotic process, positive regulation of compound eye retinal cell programmed cell death, positive regulation of cysteine-type endopeptidase activity involved in apoptotic signaling pathway, positive regulation of necrotic cell death, programmed cell death, programmed cell death involved in cell development, protein autoprocessing, regulation of autophagy, regulation of cell death, salivary gland histolysis, sperm individualization, zymogen activation |
| PubMed |
10200258
|
| Total Prosequence Length (aa) |
134 |
| Prosequence Location |
1:134 |
| Prosequence Sequence |
MQPPELEIGMPKRHREHIRKNLNILVEWTNYERLAMECVQQGILTVQMLRNTQDLNGKPFNMDEKDVRVEQHRRLLLKITQRGPTAYNLLINALRNINCLDAAVLLESVDESDSRPPFISLNERRTSRKSADIV |
| Preproprotein Sequence |
MQPPELEIGMPKRHREHIRKNLNILVEWTNYERLAMECVQQGILTVQMLRNTQDLNGKPFNMDEKDVRVEQHRRLLLKITQRGPTAYNLLINALRNINCLDAAVLLESVDESDSRPPFISLNERRTSRKSADIVDTPSPEASEGPCVSKLRNEPLGALTPYVGVVDGPEVKKSKKIHGGDSAILGTYKMQSRFNRGVLLMVNIMDYPDQNRRRIGAEKDSKSLIHLFQELNFTIFPYGNVNQDQFFKLLTMVTSSSYVQNTECFVMVLMTHGNSVEGKEKVEFCDGSVVDMQKIKDHFQTAKCPYLVNKPKVLMFPFCRGDEYDLGHPKNQGNLMEPVYTAQEEKWPDTQTEGIPSPSTNVPSLADTLVCYANTPGYVTHRDLDTGSWYIQKFCQVMADHAHDTDLEDILKKTSEAVGNKRTKKGSMQTGAYDNLGFNKKLYFNPGFFNE |
