Home Advance Search BLAST Contact Documentation/Help Feedback
Family
Protein Name
Uniprot ID
Taxonomy
Organism
Prosequence length
Functions
PreProtein length
Alt Name
Gene Name
NCBI ID
Cell Org
Process
PubMed
Total Proseq length
Proseq Loc
Prosequence Sequence

Proseq ID Family Protein Name Uniprot ID Taxonomy Organism Prosequence length Functions PreProtein length Alter Name Gene Name NCBI ID Cell Org Process PubMed Total Proseq length Proseq Loc Prosequence Sequence
PSQ00760 FD00286 Pilin P04737 Bacteria Proteobacteria Gammaproteobacteria Enterobacterales Enterobacteriaceae Escherichia Escherichia coli (strain K12) 51 None 121 F-pilin traA 83333 extracellular region, integral component of membrane, plasma membrane conjugation 6090426 51 1:51 MNAVLSVQGASAPVKKKSFFSKFTRLNMLRLARAVIPAAVLMMFFPQLAMA
PSQ00773 FND00219 Bacteriocin microcin B17 P05834 Bacteria Proteobacteria Gammaproteobacteria Enterobacterales Enterobacteriaceae Escherichia Escherichia coli 26 None 69 None mcbA 562 None cytolysis, defense response to bacterium, negative regulation of DNA replication 8183941 26 1:26 MELKASEFGVVLSVDALKLSRQSPLG
PSQ00811 FND00206 Heat-stable enterotoxin A3 P07965 Bacteria Proteobacteria Gammaproteobacteria Enterobacterales Enterobacteriaceae Escherichia Escherichia coli 34 toxin activity 72 ST-H, ST-IB, STA3 sta3 562 extracellular space pathogenesis 6759126 34 20:53 QDAKPVESSKEKITLESKKCNIAKKSNKSGPESM
PSQ00842 FD00541 ATP-dependent Clp protease proteolytic subunit P0A6G7 Bacteria Proteobacteria Gammaproteobacteria Enterobacterales Enterobacteriaceae Escherichia Escherichia coli (strain K12) 14 ATP-dependent peptidase activity, ATPase binding, identical protein binding, serine-type endopeptidase activity, serine-type peptidase activity 207 Caseinolytic protease, Endopeptidase Clp , Heat shock protein F21, Protease Ti clpP 83333 cytosol, endopeptidase Clp complex, HslUV protease complex, membrane positive regulation of programmed cell death, proteasomal protein catabolic process, protein quality control for misfolded or incompletely synthesized proteins, proteolysis, response to heat, response to radiation, response to temperature stimulus 2197275 14 1:14 MSYSGERDNFAPHM
PSQ00843 FD00355 Poly(A) polymerase I P0ABF1 Bacteria Proteobacteria Gammaproteobacteria Enterobacterales Enterobacteriaceae Escherichia Escherichia coli (strain K12) 10 ATP binding, polynucleotide adenylyltransferase activity, RNA binding 465 Plasmid copy number protein pcnB 83333 cytoplasm, cytosol, plasma membrane mRNA polyadenylation, mRNA processing, plasmid maintenance, RNA modification 1438224 10 1:10 MFTRVANFCR
PSQ00844 FD00570 Peptidoglycan D P0AD68 Bacteria Proteobacteria Gammaproteobacteria Enterobacterales Enterobacteriaceae Escherichia Escherichia coli (strain K12) 11 penicillin binding, peptidoglycan glycosyltransferase activity, serine-type D-Ala-D-Ala carboxypeptidase activity 588 Essential cell division protein FtsI , Murein transpeptidase , Penicillin-binding protein 3 , Peptidoglycan synthase FtsI ftsI 83333 cell division site, integral component of plasma membrane, intrinsic component of plasma membrane cell division, cell wall organization, division septum assembly, FtsZ-dependent cytokinesis, peptidoglycan biosynthetic process, regulation of cell shape, response to drug 2681146 11 578:588 INQGEGTGGRS
PSQ01144 FD00536 Colicin-V P22522 Bacteria Proteobacteria Gammaproteobacteria Enterobacterales Enterobacteriaceae Escherichia Escherichia coli 15 None 103 Microcin-V bacteriocin cvaC 562 extracellular region cytolysis, defense response to bacterium 7952189, 8204625 15 1:15 MRTLTLNELDSVSGG
PSQ01231 FD00206 Major structural subunit of bundle-forming pilus P33553 Bacteria Proteobacteria Gammaproteobacteria Enterobacterales Enterobacteriaceae Escherichia Escherichia coli O127 13 None 193 Bundle-forming pilin bfpA 574521 integral component of membrane, pilus None 1683004 13 1:13 MVSKIMNKKYEKG
PSQ01264 FND00366 Acid shock protein P36560 Bacteria Proteobacteria Gammaproteobacteria Enterobacterales Enterobacteriaceae Escherichia Escherichia coli (strain K12) 37 None 102 None asr 83333 periplasmic space response to zinc ion 12670971 37 22:58 AETTTTPAPTATTTKAAPAKTTHHKKQHKAAPAQKAQ
PSQ01265 FD00284 Prepilin peptidase-dependent protein D P36647 Bacteria Proteobacteria Gammaproteobacteria Enterobacterales Enterobacteriaceae Escherichia Escherichia coli (strain K12) 6 None 146 None ppdD 83333 integral component of membrane, type IV pilus type IV pilus biogenesis, type IV pilus-dependent motility 10633126 6 1:6 MDKQRG
PSQ01385 FD00206 Major structural subunit of bundle-forming pilus P58997 Bacteria Proteobacteria Gammaproteobacteria Enterobacterales Enterobacteriaceae Escherichia Escherichia coli O111 13 None 193 Bundle-forming pilin bfpA 168927 integral component of membrane, pilus None 1683004 13 1:13 MVSKIMNKKYEKG
PSQ02089 FD00564 Microcin J25 Q9X2V7 Bacteria Proteobacteria Gammaproteobacteria Enterobacterales Enterobacteriaceae Escherichia Escherichia coli 37 None 60 Class II lasso peptide , Ribosomally synthesized and post-translationally modified peptide mcjA 562 extracellular region cytolysis, defense response to bacterium 10092860 37 1:37 MIKHFHFNKLSSGKKNNVPSPAKGVIQIKKSASQLTK
Go to Lab Web Page