Home Advance Search BLAST Contact Documentation/Help Feedback

Details of PSQ02059

ProSeqID PSQ02059
Family FD00029
Protein Name Group 10 secretory phospholipase A2
UniProt ID Q9QXX3
Taxonomy Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Mammalia-Eutheria-Euarchontoglires-Glires-Rodentia-Myomorpha-Muroidea-Muridae-Murinae-Mus-Mus
Organisms Mus musculus (Mouse)
Prosequence Length (aa) 11
Functions 1-alkyl-2-acetylglycerophosphocholine esterase activity, calcium ion binding, calcium-dependent phospholipase A2 activity, phospholipase A2 activity, phospholipase A2 activity (consuming 1,2-dipalmitoylphosphatidylcholine), phospholipase A2 activity consuming 1,2-dioleoylphosphatidylethanolamine), phospholipase activity, phospholipid binding
Preproprotein Length (aa) 151
Alt Name Group X secretory phospholipase A2, Phosphatidylcholine 2-acylhydrolase 10
Gene Name Pla2g10
NCBI ID 10090
Cellular Localization acrosomal vesicle, extracellular space, lysosome
Processes arachidonic acid secretion, axon guidance, cellular response to leukemia inhibitory factor, cholesterol homeostasis, defense response to virus, erythrocyte maturation, fertilization, hair follicle morphogenesis, intestinal stem cell homeostasis, low-density lipoprotein particle remodeling, lysophospholipid transport, macrophage activation, negative regulation of cholesterol efflux, negative regulation of cytokine production involved in inflammatory response, negative regulation of DNA-binding transcription factor activity, negative regulation of inflammatory response, phosphatidic acid metabolic process, phosphatidylcholine catabolic process, phosphatidylcholine metabolic process, phosphatidylethanolamine metabolic process, phosphatidylglycerol metabolic process, phosphatidylserine metabolic process, phospholipid metabolic process, platelet activating factor catabolic process, positive regulation of acrosome reaction, positive regulation of arachidonic acid secretion, positive regulation of cellular protein metabolic process, positive regulation of lipid storage, positive regulation of prostaglandin secretion, production of molecular mediator involved in inflammatory response, prostaglandin biosynthetic process, regulation of macrophage activation
PubMed 11019817
Total Prosequence Length (aa) 11
Prosequence Location 18:28
Prosequence Sequence EATRRSHVYKR
Preproprotein Sequence MLLLLLLLLLGPGPGFSEATRRSHVYKRGLLELAGTLDCVGPRSPMAYMNYGCYCGLGGHGEPRDAIDWCCYHHDCCYSRAQDAGCSPKLDRYPWKCMDHHILCGPAENKCQELLCRCDEELAYCLAGTEYHLKYLFFPSILCEKDSPKCN