Details of PSQ01949
| ProSeqID |
PSQ01949 |
| Family |
FD00227 |
| Protein Name |
Proprotein convertase subtilisin |
| UniProt ID |
Q8NBP7
|
| Taxonomy |
Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Mammalia-Eutheria-Euarchontoglires-Primates-Haplorrhini-Catarrhini-Hominidae-Homo |
| Organisms |
Homo sapiens (Human) |
| Prosequence Length (aa) |
122 |
| Functions |
apolipoprotein binding, apolipoprotein receptor binding, low-density lipoprotein particle binding, low-density lipoprotein particle receptor binding, protein self-association, receptor inhibitor activity, RNA binding, serine-type endopeptidase activity, sodium channel inhibitor activity, very-low-density lipoprotein particle binding, very-low-density lipoprotein particle receptor binding |
| Preproprotein Length (aa) |
692 |
| Alt Name |
Neural apoptosis-regulated convertase 1, Proprotein convertase 9, Subtilisin |
| Gene Name |
PCSK9 |
| NCBI ID |
9606 |
| Cellular Localization |
cell surface, COPII-coated ER to Golgi transport vesicle, cytoplasm, early endosome, endolysosome membrane, endoplasmic reticulum, endoplasmic reticulum lumen, extracellular region, extracellular space, extrinsic component of external side of plasma membrane, Golgi apparatus, late endosome, lysosomal membrane, lysosome, PCSK9-AnxA2 complex, PCSK9-LDLR complex, perinuclear region of cytoplasm, plasma membrane, rough endoplasmic reticulum |
| Processes |
apoptotic process, cellular protein metabolic process, cellular response to insulin stimulus, cellular response to starvation, cholesterol homeostasis, cholesterol metabolic process, kidney development, lipoprotein metabolic process, liver development, low-density lipoprotein particle clearance, low-density lipoprotein particle receptor catabolic process, lysosomal transport, negative regulation of low-density lipoprotein particle clearance, negative regulation of low-density lipoprotein particle receptor binding, negative regulation of low-density lipoprotein receptor activity, negative regulation of receptor recycling, negative regulation of receptor-mediated endocytosis involved in cholesterol transport, negative regulation of sodium ion transmembrane transporter activity, neurogenesis, neuron differentiation, phospholipid metabolic process, positive regulation of low-density lipoprotein particle receptor catabolic process, positive regulation of neuron apoptotic process, positive regulation of receptor internalization, post-translational protein modification, protein autoprocessing, regulation of neuron apoptotic process, regulation of signaling receptor activity, triglyceride metabolic process |
| PubMed |
12552133
|
| Total Prosequence Length (aa) |
122 |
| Prosequence Location |
31:152 |
| Prosequence Sequence |
QEDEDGDYEELVLALRSEEDGLAEAPEHGTTATFHRCAKDPWRLPGTYVVVLKEETHLSQSERTARRLQAQAARRGYLTKILHVFHGLLPGFLVKMSGDLLELALKLPHVDYIEEDSSVFAQ |
| Preproprotein Sequence |
MGTVSSRRSWWPLPLLLLLLLLLGPAGARAQEDEDGDYEELVLALRSEEDGLAEAPEHGTTATFHRCAKDPWRLPGTYVVVLKEETHLSQSERTARRLQAQAARRGYLTKILHVFHGLLPGFLVKMSGDLLELALKLPHVDYIEEDSSVFAQSIPWNLERITPPRYRADEYQPPDGGSLVEVYLLDTSIQSDHREIEGRVMVTDFENVPEEDGTRFHRQASKCDSHGTHLAGVVSGRDAGVAKGASMRSLRVLNCQGKGTVSGTLIGLEFIRKSQLVQPVGPLVVLLPLAGGYSRVLNAACQRLARAGVVLVTAAGNFRDDACLYSPASAPEVITVGATNAQDQPVTLGTLGTNFGRCVDLFAPGEDIIGASSDCSTCFVSQSGTSQAAAHVAGIAAMMLSAEPELTLAELRQRLIHFSAKDVINEAWFPEDQRVLTPNLVAALPPSTHGAGWQLFCRTVWSAHSGPTRMATAVARCAPDEELLSCSSFSRSGKRRGERMEAQGGKLVCRAHNAFGGEGVYAIARCCLLPQANCSVHTAPPAEASMGTRVHCHQQGHVLTGCSSHWEVEDLGTHKPPVLRPRGQPNQCVGHREASIHASCCHAPGLECKVKEHGIPAPQEQVTVACEEGWTLTGCSALPGTSHVLGAYAVDNTCVVRSRDVSTTGSTSEGAVTAVAICCRSRHLAQASQELQ |
