Details of PSQ01240
| ProSeqID |
PSQ01240 |
| Family |
FD00039 |
| Protein Name |
Macrophage metalloelastase |
| UniProt ID |
P34960
|
| Taxonomy |
Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Mammalia-Eutheria-Euarchontoglires-Glires-Rodentia-Myomorpha-Muroidea-Muridae-Murinae-Mus-Mus |
| Organisms |
Mus musculus (Mouse) |
| Prosequence Length (aa) |
81 |
| Functions |
calcium ion binding, collagen binding, core promoter sequence-specific DNA binding, metalloendopeptidase activity, sequence-specific DNA binding, zinc ion binding |
| Preproprotein Length (aa) |
480 |
| Alt Name |
Matrix metalloproteinase-12 |
| Gene Name |
Mmp12 |
| NCBI ID |
10090 |
| Cellular Localization |
cytoplasm, extracellular matrix, extracellular region, extracellular space, nucleus |
| Processes |
bronchiole development, cellular response to virus, collagen catabolic process, elastin catabolic process, extracellular matrix organization, lung alveolus development, negative regulation of endothelial cell-matrix adhesion via fibronectin, negative regulation of transcription by RNA polymerase II, negative regulation of type I interferon-mediated signaling pathway, positive regulation of epithelial cell proliferation involved in wound healing, positive regulation of gene expression, positive regulation of interferon-alpha production, positive regulation of transcription by RNA polymerase II, positive regulation of type I interferon-mediated signaling pathway, protein import into nucleus, proteolysis, regulation of defense response to virus by host, regulation of trophoblast cell migration, wound healing, spreading of epidermal cells |
| PubMed |
1537850
|
| Total Prosequence Length (aa) |
81 |
| Prosequence Location |
29:109 |
| Prosequence Sequence |
APMNDSEFAEWYLSRFYDYGKDRIPMTKTKTNRNFLKEKLQEMQQFFGLEATGQLDNSTLAIMHIPRCGVPDVQHLRAVPQ |
| Preproprotein Sequence |
MSCTLLKGVCTMKFLMMIVFLQVSACGAAPMNDSEFAEWYLSRFYDYGKDRIPMTKTKTNRNFLKEKLQEMQQFFGLEATGQLDNSTLAIMHIPRCGVPDVQHLRAVPQRSRWMKRYLTYRIYNYTPDMKREDVDYIFQKAFQVWSDVTPLRFRKLHKDEADIMILFAFGAHGDFNYFDGKGGTLAHAFYPGPGIQGDAHFDEAETWTKSFQGTNLFLVAVHELGHSLGLQHSNNPKSIMYPTYRYLNPSTFRLSADDIRNIQSLYGAPVKPPSLTKPSSPPSTFCHQSLSFDAVTTVGEKIFFFKDWFFWWKLPGSPATNITSISSIWPSIPSGIQAAYEIESRNQLFLFKDEKYWLINNLVPEPHYPRSIYSLGFSASVKKVDAAVFDPLRQKVYFFVDKHYWRYDVRQELMDPAYPKLISTHFPGIKPKIDAVLYFKRHYYIFQGAYQLEYDPLFRRVTKTLKSTSWFGC |
