Details of PSQ00750
| ProSeqID |
PSQ00750 |
| Family |
FD00039 |
| Protein Name |
Stromelysin-1 |
| UniProt ID |
P03957
|
| Taxonomy |
Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Mammalia-Eutheria-Euarchontoglires-Glires-Rodentia-Myomorpha-Muroidea-Muridae-Murinae-Rattus |
| Organisms |
Rattus norvegicus (Rat) |
| Prosequence Length (aa) |
80 |
| Functions |
endopeptidase activity, metalloendopeptidase activity, metallopeptidase activity, peptidase activity, protein-containing complex binding, zinc ion binding |
| Preproprotein Length (aa) |
480 |
| Alt Name |
Matrix metalloproteinase-3, PTR1 protein, Transin-1 |
| Gene Name |
Mmp3 |
| NCBI ID |
10116 |
| Cellular Localization |
cell body, cytosol, dendrite, extracellular matrix, extracellular space, mitochondrion, nucleus, protein-containing complex |
| Processes |
cellular response to amino acid stimulus, cellular response to cell-matrix adhesion, cellular response to interleukin-1, cellular response to UV-A, collagen catabolic process, extracellular matrix organization, female pregnancy, negative regulation of hydrogen peroxide metabolic process, negative regulation of protein kinase B signaling, positive regulation of cell migration, positive regulation of oxidative stress-induced cell death, positive regulation of protein-containing complex assembly, protein catabolic process, proteolysis, regulation of cell migration, response to amino acid, response to cytokine, response to estradiol, response to hypoxia, response to interleukin-1, response to lipopolysaccharide, response to mechanical stimulus, response to tumor necrosis factor, wound healing |
| PubMed |
2841336
|
| Total Prosequence Length (aa) |
80 |
| Prosequence Location |
18:97 |
| Prosequence Sequence |
YPLHGSEEDAGMEVLQKYLENYYGLEKDVKQFTKKKDSSPVVKKIQEMQKFLGLKMTGKLDSNTMELMHKPRCGVPDVGG |
| Preproprotein Sequence |
MKGLPVLLWLCTAVCSSYPLHGSEEDAGMEVLQKYLENYYGLEKDVKQFTKKKDSSPVVKKIQEMQKFLGLKMTGKLDSNTMELMHKPRCGVPDVGGFSTFPGSPKWRKNHISYRIVNYTLDLPRESVDSAIERALKVWEEVTPLTFSRISEGEADIMISFAVEEHGDFIPFDGPGMVLAHAYAPGPGTNGDAHFDDDERWTDDVTGTNLFLVAAHELGHSLGLFHSANAEALMYPVYKSSTDLARFHLSQDDVDGIQSLYGPPTESPDVLVVPTKSNSLDPETLPMCSSALSFDAVSTLRGEVLFFKDRHFWRKSLRTPEPGFYLISSFWPSLPSNMDAAYEVTNRDTVFILKGNQIWAIRGHEELAGYPKSIHTLGLPETVQKIDAAISLKDQKKTYFFVEDKFWRFDEKKQSMDPEFPRKIAENFPGIGTKVDAVFEAFGFLYFFSGSSQLEFDPNAGKVTHILKSNSWFNC |
