Home Advance Search BLAST Contact Documentation/Help Feedback

Details of PSQ00710

ProSeqID PSQ00710
Family FD00165
Protein Name Parathyroid hormone
UniProt ID P01269
Taxonomy Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Mammalia-Eutheria-Laurasiatheria-Artiodactyla-Suina-Suidae-Sus
Organisms Sus scrofa (Pig)
Prosequence Length (aa) 6
Functions hormone activity, parathyroid hormone receptor binding, peptide hormone receptor binding, protein N-terminus binding, type 1 parathyroid hormone receptor binding
Preproprotein Length (aa) 120
Alt Name Parathyrin
Gene Name PTH
NCBI ID 9823
Cellular Localization extracellular space
Processes activation of phospholipase C activity, adenylate cyclase-activating G protein-coupled receptor signaling pathway, cell-cell signaling, cellular calcium ion homeostasis, cellular macromolecule biosynthetic process, homeostasis of number of cells within a tissue, magnesium ion homeostasis, negative regulation of apoptotic process in bone marrow cell, negative regulation of gene expression, phosphate ion homeostasis, positive regulation of bone mineralization, positive regulation of cell proliferation in bone marrow, positive regulation of glucose import, positive regulation of glycogen biosynthetic process, positive regulation of inositol phosphate biosynthetic process, positive regulation of osteoclast proliferation, positive regulation of signal transduction, positive regulation of transcription by RNA polymerase II
PubMed 4840833
Total Prosequence Length (aa) 6
Prosequence Location 26:31
Prosequence Sequence KPIKKR
Preproprotein Sequence MMSAKDTVKVMVVMLAICFLARSDGKPIKKRSVSEIQLMHNLGKHLSSLERVEWLRKKLQDVHNFVALGASIVHRDGGSQRPRKKEDNVLVESHQKSLGEADKAAVDVLIKAKPQ