Home Advance Search BLAST Contact Documentation/Help Feedback

Details of PSQ00706

ProSeqID PSQ00706
Family FD00052
Protein Name Corticoliberin
UniProt ID P01143
Taxonomy Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Mammalia-Eutheria-Euarchontoglires-Glires-Rodentia-Myomorpha-Muroidea-Muridae-Murinae-Rattus
Organisms Rattus norvegicus (Rat)
Prosequence Length (aa) 120
Functions corticotropin-releasing hormone activity, corticotropin-releasing hormone receptor 1 binding, corticotropin-releasing hormone receptor 2 binding
Preproprotein Length (aa) 187
Alt Name Corticotropin-releasing factor, Corticotropin-releasing hormone
Gene Name Crh
NCBI ID 10116
Cellular Localization cytoplasm, extracellular space, neuronal cell body, perikaryon, synapse, varicosity
Processes adrenal gland development, associative learning, cellular response to cocaine, cellular response to dexamethasone stimulus, diterpenoid metabolic process, female pregnancy, glucocorticoid biosynthetic process, hormone-mediated apoptotic signaling pathway, hypothalamus development, inflammatory response, ion homeostasis, learning or memory, locomotory exploration behavior, long-term synaptic potentiation, lung development, negative regulation of cell death, negative regulation of epinephrine secretion, negative regulation of gene expression, negative regulation of glucagon secretion, negative regulation of luteinizing hormone secretion, negative regulation of norepinephrine secretion, negative regulation of systemic arterial blood pressure, positive regulation of behavioral fear response, positive regulation of calcium ion import, positive regulation of cAMP-mediated signaling, positive regulation of cell death, positive regulation of cell population proliferation, positive regulation of corticosterone secretion, positive regulation of corticotropin secretion, positive regulation of cortisol secretion, positive regulation of digestive system process, positive regulation of gene expression, positive regulation of insulin secretion involved in cellular response to glucose stimulus, positive regulation of protein phosphorylation, regulation of NMDA receptor activity, regulation of serotonin secretion, response to cocaine, response to corticosterone, response to drug, response to estrogen, response to ethanol, response to ether, response to immobilization stress, response to pain, steroid metabolic process, synaptic transmission, dopaminergic
PubMed 6603620
Total Prosequence Length (aa) 120
Prosequence Location 25:144
Prosequence Sequence LLSRGSVSGAPRAPQPLNFLQPEQPQQPQPILIRMGEEYFLRLGNLNRSPAARLSPNSTPLTAGRGSRPSHDQAAANFFRVLLQQLQMPQRPLDSSTELAERGAEDALGGHQGALERERR
Preproprotein Sequence MRLRLLVSAGMLLVALSPCLPCRALLSRGSVSGAPRAPQPLNFLQPEQPQQPQPILIRMGEEYFLRLGNLNRSPAARLSPNSTPLTAGRGSRPSHDQAAANFFRVLLQQLQMPQRPLDSSTELAERGAEDALGGHQGALERERRSEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEIIGK