Home Advance Search BLAST Contact Documentation/Help Feedback

Details of PSQ00704

ProSeqID PSQ00704
Family FD00109
Protein Name Beta-nerve growth factor
UniProt ID P01139
Taxonomy Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Mammalia-Eutheria-Euarchontoglires-Glires-Rodentia-Myomorpha-Muroidea-Muridae-Murinae-Mus-Mus
Organisms Mus musculus (Mouse)
Prosequence Length (aa) 103
Functions cysteine-type endopeptidase activator activity involved in apoptotic process, death receptor agonist activity, growth factor activity, lipid binding, metalloendopeptidase inhibitor activity, nerve growth factor receptor binding, transmembrane receptor protein tyrosine kinase activator activity
Preproprotein Length (aa) 241
Alt Name None
Gene Name Ngf
NCBI ID 10090
Cellular Localization axon, dendrite, endoplasmic reticulum lumen, endosome lumen, extracellular region, extracellular space, neuron projection terminus, synaptic vesicle
Processes activation of cysteine-type endopeptidase activity involved in apoptotic process, adult locomotory behavior, circadian rhythm, extrinsic apoptotic signaling pathway in absence of ligand, extrinsic apoptotic signaling pathway via death domain receptors, memory, modulation of chemical synaptic transmission, negative regulation of neuron apoptotic process, negative regulation of type B pancreatic cell apoptotic process, nerve development, nerve growth factor signaling pathway, neuron apoptotic process, neuron development, neuron projection development, neuron projection morphogenesis, peripheral nervous system development, positive regulation of axon extension, positive regulation of cell growth, positive regulation of cell population proliferation, positive regulation of collateral sprouting, positive regulation of DNA binding, positive regulation of DNA-binding transcription factor activity, positive regulation of ERK1 and ERK2 cascade, positive regulation of gene expression, positive regulation of neuron differentiation, positive regulation of neuron maturation, positive regulation of neuron projection development, positive regulation of neurotrophin TRK receptor signaling pathway, positive regulation of peptidyl-serine phosphorylation, positive regulation of protein autophosphorylation, positive regulation of protein binding, positive regulation of protein phosphorylation, positive regulation of protein ubiquitination, positive regulation of Ras protein signal transduction, positive regulation of stem cell proliferation, regulation of neuron differentiation, regulation of neurotransmitter secretion, regulation of release of sequestered calcium ion into cytosol, sensory perception of pain, transmembrane receptor protein tyrosine kinase signaling pathway
PubMed 20036257, 4566923
Total Prosequence Length (aa) 103
Prosequence Location 19:121
Prosequence Sequence EPYTDSNVPEGDSVPEAHWTKLQHSLDTALRRARSAPTAPIAARVTGQTRNITVDPRLFKKRRLHSPRVLFSTQPPPTSSDTLDLDFQAHGTIPFNRTHRSKR
Preproprotein Sequence MSMLFYTLITAFLIGVQAEPYTDSNVPEGDSVPEAHWTKLQHSLDTALRRARSAPTAPIAARVTGQTRNITVDPRLFKKRRLHSPRVLFSTQPPPTSSDTLDLDFQAHGTIPFNRTHRSKRSSTHPVFHMGEFSVCDSVSVWVGDKTTATDIKGKEVTVLAEVNINNSVFRQYFFETKCRASNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDEKQAAWRFIRIDTACVCVLSRKATRRG