Details of PSQ00693
| ProSeqID |
PSQ00693 |
| Family |
FD00082 |
| Protein Name |
Cathepsin B |
| UniProt ID |
P00787
|
| Taxonomy |
Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Mammalia-Eutheria-Euarchontoglires-Glires-Rodentia-Myomorpha-Muroidea-Muridae-Murinae-Rattus |
| Organisms |
Rattus norvegicus (Rat) |
| Prosequence Length (aa) |
62 |
| Functions |
collagen binding, cysteine-type endopeptidase activity, cysteine-type peptidase activity, endopeptidase activity, kininogen binding, peptidase activity, peptide binding, protein self-association, protein-containing complex binding, proteoglycan binding |
| Preproprotein Length (aa) |
339 |
| Alt Name |
Cathepsin B1, RSG-2 |
| Gene Name |
Ctsb |
| NCBI ID |
10116 |
| Cellular Localization |
apical plasma membrane, cell surface, cytoplasm, external side of plasma membrane, extracellular region, extracellular space, lysosome, melanosome, mitochondrion, perinuclear region of cytoplasm, sarcolemma |
| Processes |
autophagy, cellular response to mechanical stimulus, cellular response to thyroid hormone stimulus, collagen catabolic process, decidualization, epithelial cell differentiation, negative regulation of cell death, proteolysis, proteolysis involved in cellular protein catabolic process, regulation of catalytic activity, response to amine, response to cytokine, response to ethanol, response to glucose, response to interleukin-4, response to mechanical stimulus, response to organic cyclic compound, response to peptide hormone, response to wounding, skeletal muscle tissue development, spermatogenesis, thyroid hormone generation, viral entry into host cell |
| PubMed |
1639824,
6574504
|
| Total Prosequence Length (aa) |
62 |
| Prosequence Location |
18:79 |
| Prosequence Sequence |
HDKPSSHPLSDDMINYINKQNTTWQAGRNFYNVDISYLKKLCGTVLGGPNLPERVGFSEDIN |
| Preproprotein Sequence |
MWWSLIPLSCLLALTSAHDKPSSHPLSDDMINYINKQNTTWQAGRNFYNVDISYLKKLCGTVLGGPNLPERVGFSEDINLPESFDAREQWSNCPTIAQIRDQGSCGSCWAFGAVEAMSDRICIHTNGRVNVEVSAEDLLTCCGIQCGDGCNGGYPSGAWNFWTRKGLVSGGVYNSHIGCLPYTIPPCEHHVNGSRPPCTGEGDTPKCNKMCEAGYSTSYKEDKHYGYTSYSVSDSEKEIMAEIYKNGPVEGAFTVFSDFLTYKSGVYKHEAGDVMGGHAIRILGWGIENGVPYWLVANSWNVDWGDNGFFKILRGENHCGIESEIVAGIPRTQQYWGRF |
