Home Advance Search BLAST Contact Documentation/Help Feedback

Details of PSQ02097

ProSeqID PSQ02097
Family FD00448
Protein Name Heparanase
UniProt ID Q9Y251
Taxonomy Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Mammalia-Eutheria-Euarchontoglires-Primates-Haplorrhini-Catarrhini-Hominidae-Homo
Organisms Homo sapiens (Human)
Prosequence Length (aa) 48
Functions beta-glucuronidase activity, heparanase activity, syndecan binding
Preproprotein Length (aa) 543
Alt Name Endo-glucoronidase, Heparanase-1
Gene Name HPSE
NCBI ID 9606
Cellular Localization extracellular matrix, extracellular region, heparanase complex, intracellular membrane-bounded organelle, lysosomal lumen, lysosomal membrane, lysosome, membrane raft, nucleoplasm, nucleus, specific granule lumen
Processes angiogenesis involved in wound healing, cell-matrix adhesion, glycosaminoglycan catabolic process, heparan sulfate proteoglycan catabolic process, neutrophil degranulation, positive regulation of blood coagulation, positive regulation of hair follicle development, positive regulation of osteoblast proliferation, positive regulation of protein kinase B signaling, positive regulation of vascular endothelial growth factor production, proteoglycan metabolic process, regulation of hair follicle development, vascular wound healing
PubMed 10395326, 10446189, 12713442
Total Prosequence Length (aa) 48
Prosequence Location 110:157
Prosequence Sequence STFEERSYWQSQVNQDICKYGSIPPDVEEKLRLEWPYQEQLLLREHYQ
Preproprotein Sequence MLLRSKPALPPPLMLLLLGPLGPLSPGALPRPAQAQDVVDLDFFTQEPLHLVSPSFLSVTIDANLATDPRFLILLGSPKLRTLARGLSPAYLRFGGTKTDFLIFDPKKESTFEERSYWQSQVNQDICKYGSIPPDVEEKLRLEWPYQEQLLLREHYQKKFKNSTYSRSSVDVLYTFANCSGLDLIFGLNALLRTADLQWNSSNAQLLLDYCSSKGYNISWELGNEPNSFLKKADIFINGSQLGEDFIQLHKLLRKSTFKNAKLYGPDVGQPRRKTAKMLKSFLKAGGEVIDSVTWHHYYLNGRTATKEDFLNPDVLDIFISSVQKVFQVVESTRPGKKVWLGETSSAYGGGAPLLSDTFAAGFMWLDKLGLSARMGIEVVMRQVFFGAGNYHLVDENFDPLPDYWLSLLFKKLVGTKVLMASVQGSKRRKLRVYLHCTNTDNPRYKEGDLTLYAINLHNVTKYLRLPYPFSNKQVDKYLLRPLGPHGLLSKSVQLNGLTLKMVDDQTLPPLMEKPLRPGSSLGLPAFSYSFFVIRNAKVAACI