Details of PSQ02072
| ProSeqID |
PSQ02072 |
| Family |
FD00120 |
| Protein Name |
Putative inactive caspase B |
| UniProt ID |
Q9TZP5
|
| Taxonomy |
Eukaryota-Metazoa-Ecdysozoa-Nematoda-Chromadorea-Rhabditida-Rhabditina-Rhabditomorpha-Rhabditoidea-Rhabditidae-Peloderinae-Caenorhabditis |
| Organisms |
Caenorhabditis elegans |
| Prosequence Length (aa) |
8 |
| Functions |
caspase binding, cysteine-type endopeptidase activity involved in apoptotic process, cysteine-type endopeptidase activity involved in apoptotic signaling pathway, cysteine-type endopeptidase activity involved in execution phase of apoptosis, cysteine-type endopeptidase inhibitor activity involved in apoptotic process, zymogen binding |
| Preproprotein Length (aa) |
263 |
| Alt Name |
None |
| Gene Name |
csp-2 |
| NCBI ID |
6239 |
| Cellular Localization |
cytoplasm, protease inhibitor complex |
| Processes |
activation of cysteine-type endopeptidase activity involved in apoptotic process, apoptotic process, execution phase of apoptosis, inhibition of cysteine-type endopeptidase activity involved in apoptotic process, negative regulation of apoptotic process, positive regulation of apoptotic process involved in development, positive regulation of brood size, positive regulation of fertilization |
| PubMed |
9857046
|
| Total Prosequence Length (aa) |
8 |
| Prosequence Location |
1:8 |
| Prosequence Sequence |
MMCEDASD |
| Preproprotein Sequence |
MMCEDASDGKKIDETRKYRNNRSSKCRAIIINNVVFCGMEKRIGSDKDKKKLSKLFERLGYQSTSYDNLKSSEILETVRQFTQSNHGDSLIITIMSHGDQGLLYGVDGVPVQMLDIIDLMCTASLAKKPKWLMCVCCRGDRIDRAVRCDGFIDNFFDRFPKFFQFMKSKFPSHQTSSSQADLLVSFSTSPGFLSFRDETKGTWYIQELYRVIIENAKDTHLADLLMETNRRVVEKYEADKVVIVCKQAPEFWSRFTKQLFFDV |
