Home Advance Search BLAST Contact Documentation/Help Feedback

Details of PSQ01865

ProSeqID PSQ01865
Family FD00104
Protein Name Regenerating islet-derived protein 3-gamma
UniProt ID Q6UW15
Taxonomy Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Mammalia-Eutheria-Euarchontoglires-Primates-Haplorrhini-Catarrhini-Hominidae-Homo
Organisms Homo sapiens (Human)
Prosequence Length (aa) 11
Functions oligosaccharide binding, peptidoglycan binding, signaling receptor activity
Preproprotein Length (aa) 180
Alt Name Pancreatitis-associated protein 1B, Pancreatitis-associated protein IB, Regenerating islet-derived protein III-gamma
Gene Name REG3G
NCBI ID 9606
Cellular Localization cytoplasm, extracellular region, extracellular space
Processes acute-phase response, antimicrobial humoral immune response mediated by antimicrobial peptide, antimicrobial humoral response, cell wall disruption in other organism, cytolysis by host of symbiont cells, defense response to Gram-positive bacterium, MyD88-dependent toll-like receptor signaling pathway, negative regulation of keratinocyte differentiation, positive regulation of cell population proliferation, positive regulation of keratinocyte proliferation, positive regulation of wound healing, response to peptide hormone
PubMed 19095652
Total Prosequence Length (aa) 11
Prosequence Location 27:37
Prosequence Sequence EETQKELPSPR
Preproprotein Sequence MLPPMALPSVSWMLLSCLILLCQVQGEETQKELPSPRISCPKGSKAYGSPCYALFLSPKSWMDADLACQKRPSGKLVSVLSGAEGSFVSSLVRSISNSYSYIWIGLHDPTQGSEPDGDGWEWSSTDVMNYFAWEKNPSTILNPGHCGSLSRSTGFLKWKDYNCDAKLPYVCKFKD