Details of PSQ01749
| ProSeqID |
PSQ01749 |
| Family |
FD00022 |
| Protein Name |
Defensin alpha-like protein 1 |
| UniProt ID |
Q4JEI2
|
| Taxonomy |
Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Mammalia-Eutheria-Euarchontoglires-Glires-Rodentia-Myomorpha-Muroidea-Muridae-Murinae-Rattus |
| Organisms |
Rattus norvegicus (Rat) |
| Prosequence Length (aa) |
37 |
| Functions |
None |
| Preproprotein Length (aa) |
87 |
| Alt Name |
Defensin alpha-related sequence 1 , Rattusin |
| Gene Name |
Defal1 |
| NCBI ID |
10116 |
| Cellular Localization |
extracellular space |
| Processes |
antibacterial humoral response, antimicrobial humoral immune response mediated by antimicrobial peptide, cellular response to lipopolysaccharide, defense response to Gram-negative bacterium, defense response to Gram-positive bacterium, innate immune response in mucosa, membrane disruption in other organism |
| PubMed |
23380721
|
| Total Prosequence Length (aa) |
37 |
| Prosequence Location |
20:56 |
| Prosequence Sequence |
DPIQEAEEETKTEEQPADEDQDVSVSFEGPEASAVQD |
| Preproprotein Sequence |
MKTLILLSALVLLALQVQADPIQEAEEETKTEEQPADEDQDVSVSFEGPEASAVQDLRVRRTLQCSCRRVCRNTCSCIRLSRSTYAS |