Details of PSQ01391
| ProSeqID |
PSQ01391 |
| Family |
FD00016 |
| Protein Name |
Neutrophil defensin 1 |
| UniProt ID |
P60030
|
| Taxonomy |
Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Mammalia-Eutheria-Euarchontoglires-Primates-Haplorrhini-Catarrhini-Cercopithecidae-Cercopithecinae-Macaca |
| Organisms |
Macaca mulatta (Rhesus macaque) |
| Prosequence Length (aa) |
47 |
| Functions |
None |
| Preproprotein Length (aa) |
96 |
| Alt Name |
RMAD-1 |
| Gene Name |
None |
| NCBI ID |
9544 |
| Cellular Localization |
extracellular space |
| Processes |
antibacterial humoral response, antimicrobial humoral immune response mediated by antimicrobial peptide, cellular response to lipopolysaccharide, defense response to fungus, defense response to Gram-negative bacterium, defense response to Gram-positive bacterium, innate immune response in mucosa, killing of cells of other organism, membrane disruption in other organism |
| PubMed |
10531277
|
| Total Prosequence Length (aa) |
47 |
| Prosequence Location |
20:66 |
| Prosequence Sequence |
EPLQARTDEATAAQEQIPTDNPEVVVSLAWDESLAPKDSVPGLRKNM |
| Preproprotein Sequence |
MRTLVILAAILLVALQAQAEPLQARTDEATAAQEQIPTDNPEVVVSLAWDESLAPKDSVPGLRKNMACYCRIPACLAGERRYGTCFYLGRVWAFCC |