Details of PSQ01311
| ProSeqID |
PSQ01311 |
| Family |
FND00356 |
| Protein Name |
Gallinacin-2 |
| UniProt ID |
P46158
|
| Taxonomy |
Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Archelosauria-Archosauria-Dinosauria-Saurischia-Theropoda-Coelurosauria-Aves-Neognathae-Galloanserae-Galliformes-Phasianidae-Phasianinae-Gallus |
| Organisms |
Gallus gallus (Chicken) |
| Prosequence Length (aa) |
6 |
| Functions |
CCR6 chemokine receptor binding, chemoattractant activity |
| Preproprotein Length (aa) |
64 |
| Alt Name |
Beta-defensin 2 |
| Gene Name |
GAL2 |
| NCBI ID |
9031 |
| Cellular Localization |
extracellular space, secretory granule |
| Processes |
cell chemotaxis, defense response, defense response to bacterium |
| PubMed |
19151352,
8150085
|
| Total Prosequence Length (aa) |
6 |
| Prosequence Location |
23:28 |
| Prosequence Sequence |
SPRRDM |
| Preproprotein Sequence |
MRILYLLFSLLFLALQVSPGLSSPRRDMLFCKGGSCHFGGCPSHLIKVGSCFGFRSCCKWPWNA |