Details of PSQ01310
| ProSeqID |
PSQ01310 |
| Family |
FND00040 |
| Protein Name |
Gallinacin-1 alpha |
| UniProt ID |
P46157
|
| Taxonomy |
Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Archelosauria-Archosauria-Dinosauria-Saurischia-Theropoda-Coelurosauria-Aves-Neognathae-Galloanserae-Galliformes-Phasianidae-Phasianinae-Gallus |
| Organisms |
Gallus gallus (Chicken) |
| Prosequence Length (aa) |
6 |
| Functions |
CCR6 chemokine receptor binding, chemoattractant activity |
| Preproprotein Length (aa) |
65 |
| Alt Name |
Antimicrobial peptide CHP2, Chicken heterophil peptide 2 |
| Gene Name |
None |
| NCBI ID |
9031 |
| Cellular Localization |
extracellular space, secretory granule |
| Processes |
cell chemotaxis, defense response, defense response to bacterium, defense response to fungus, killing of cells of other organism |
| PubMed |
7964174,
8150085
|
| Total Prosequence Length (aa) |
6 |
| Prosequence Location |
20:25 |
| Prosequence Sequence |
GSSQAL |
| Preproprotein Sequence |
MRIVYLLLPFILLLAQGAAGSSQALGRKSDCFRKNGFCAFLKCPYLTLISGKCSRFHLCCKRIWG |