Home Advance Search BLAST Contact Documentation/Help Feedback

Details of PSQ01310

ProSeqID PSQ01310
Family FND00040
Protein Name Gallinacin-1 alpha
UniProt ID P46157
Taxonomy Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Archelosauria-Archosauria-Dinosauria-Saurischia-Theropoda-Coelurosauria-Aves-Neognathae-Galloanserae-Galliformes-Phasianidae-Phasianinae-Gallus
Organisms Gallus gallus (Chicken)
Prosequence Length (aa) 6
Functions CCR6 chemokine receptor binding, chemoattractant activity
Preproprotein Length (aa) 65
Alt Name Antimicrobial peptide CHP2, Chicken heterophil peptide 2
Gene Name None
NCBI ID 9031
Cellular Localization extracellular space, secretory granule
Processes cell chemotaxis, defense response, defense response to bacterium, defense response to fungus, killing of cells of other organism
PubMed 7964174, 8150085
Total Prosequence Length (aa) 6
Prosequence Location 20:25
Prosequence Sequence GSSQAL
Preproprotein Sequence MRIVYLLLPFILLLAQGAAGSSQALGRKSDCFRKNGFCAFLKCPYLTLISGKCSRFHLCCKRIWG