Home Advance Search BLAST Contact Documentation/Help Feedback

Details of PSQ01309

ProSeqID PSQ01309
Family FND00040
Protein Name Gallinacin-1
UniProt ID P46156
Taxonomy Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Archelosauria-Archosauria-Dinosauria-Saurischia-Theropoda-Coelurosauria-Aves-Neognathae-Galloanserae-Galliformes-Phasianidae-Phasianinae-Gallus
Organisms Gallus gallus (Chicken)
Prosequence Length (aa) 6
Functions CCR6 chemokine receptor binding, chemoattractant activity
Preproprotein Length (aa) 65
Alt Name Beta-defensin 1
Gene Name GAL1
NCBI ID 9031
Cellular Localization extracellular space, secretory granule
Processes cell chemotaxis, defense response, defense response to bacterium, defense response to fungus, killing of cells of other organism
PubMed 8150085
Total Prosequence Length (aa) 6
Prosequence Location 20:25
Prosequence Sequence GSSQAL
Preproprotein Sequence MRIVYLLLPFILLLAQGAAGSSQALGRKSDCFRKSGFCAFLKCPSLTLISGKCSRFYLCCKRIWG