Home Advance Search BLAST Contact Documentation/Help Feedback

Details of PSQ01099

ProSeqID PSQ01099
Family FD00072
Protein Name Photosystem II reaction center protein K
UniProt ID P18263
Taxonomy Eukaryota-Viridiplantae-Chlorophyta-Core-Chlorophytes-Chlorophyceae-Chlamydomonadales-Chlamydomonadaceae-Chlamydomonas
Organisms Chlamydomonas reinhardtii (Chlamydomonas smithii)
Prosequence Length (aa) 9
Functions None
Preproprotein Length (aa) 46
Alt Name None
Gene Name psbK
NCBI ID 3055
Cellular Localization chloroplast thylakoid membrane, integral component of membrane, photosystem II reaction center
Processes photosynthesis
PubMed 1885590
Total Prosequence Length (aa) 9
Prosequence Location 1:9
Prosequence Sequence MTTLALVLA
Preproprotein Sequence MTTLALVLAKLPEAYAPFAPIVDVLPVIPVFFILLAFVWQAAVSFR